KEGG   Arabidopsis thaliana (thale cress): AT4G19170Help
Entry
AT4G19170         CDS       T00041                                 

Gene name
NCED4
Definition
(RefSeq) nine-cis-epoxycarotenoid dioxygenase 4
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00906  Carotenoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    AT4G19170 (NCED4)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     AT4G19170 (NCED4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 827655
NCBI-ProteinID: NP_193652
MIPS: AT4G19170.1
TAIR: AT4G19170
Araport: AT4G19170
UniProt: O49675
Position
4
AA seq 595 aa AA seqDB search
MDSVSSSSFLSSTFSLHHSLLRRRSSSPTLLRINSAVVEERSPITNPSDNNDRRNKPKTL
HNRTNHTLVSSPPKLRPEMTLATALFTTVEDVINTFIDPPSRPSVDPKHVLSDNFAPVLD
ELPPTDCEIIHGTLPLSLNGAYIRNGPNPQFLPRGPYHLFDGDGMLHAIKIHNGKATLCS
RYVKTYKYNVEKQTGAPVMPNVFSGFNGVTASVARGALTAARVLTGQYNPVNGIGLANTS
LAFFSNRLFALGESDLPYAVRLTESGDIETIGRYDFDGKLAMSMTAHPKTDPITGETFAF
RYGPVPPFLTYFRFDSAGKKQRDVPIFSMTSPSFLHDFAITKRHAIFAEIQLGMRMNMLD
LVLEGGSPVGTDNGKTPRLGVIPKYAGDESEMKWFEVPGFNIIHAINAWDEDDGNSVVLI
APNIMSIEHTLERMDLVHALVEKVKIDLVTGIVRRHPISARNLDFAVINPAFLGRCSRYV
YAAIGDPMPKISGVVKLDVSKGDRDDCTVARRMYGSGCYGGEPFFVARDPGNPEAEEDDG
YVVTYVHDEVTGESKFLVMDAKSPELEIVAAVRLPRRVPYGFHGLFVKESDLNKL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggactctgtttcttcttcttccttcctctcctccacattctctcttcatcactctctt
cttcgccgccgatcttcctctcctactctcctccgtatcaactccgccgtcgtcgaagaa
cgttctccaatcacaaacccaagcgacaacaatgatcgtcgtaacaaacccaaaacactc
cacaaccgaaccaatcacaccttagtctcatcaccaccgaaactccgaccagaaatgact
ctcgcaacagctctcttcaccaccgtcgaagatgtaatcaacacgttcatcgatccacct
tcacgtccttccgttgatccaaaacatgtcctctctgataacttcgctcctgtcctcgac
gagcttcctccaacagactgtgaaatcatccacggcactcttccactgtcacttaacggc
gcttacatccgtaacggtccaaatccacagtttctccctcgtggtccttaccatctcttc
gacggcgacggtatgcttcacgccataaaaatccacaacggtaaagccactctctgtagc
agatacgtcaagacttataaatacaacgtcgagaaacaaaccggagctccggttatgcct
aacgtgttttccggattcaacggtgtaacggcgtcagtagctcgtggagctttaacggca
gctagggttttaaccggacagtataatccggttaacggcattggtttagctaatacaagt
ctagctttcttcagtaaccgtctctttgctttaggtgaatctgatttaccctacgccgtc
cgattaaccgaatcaggagatattgaaacgatcggacggtacgatttcgacgggaaatta
gcgatgagtatgacagctcatcctaaaaccgatccaataaccggagaaactttcgctttc
cggtacggtccggttccaccgtttttaacatatttccggtttgattccgccgggaaaaaa
caaagagacgttccgatattctcgatgacgtctccgtcgtttctccatgacttcgcgatc
acgaaacgtcacgcgattttcgcagagattcagcttggcatgaggatgaacatgttggat
ttggttctcgaaggtggttctccggttggtactgataacggaaaaactccaaggcttgga
gtgattcctaagtacgccggagatgagtcggagatgaaatggttcgaagttcctggattc
aatatcattcacgctattaatgcttgggatgaagatgatggaaacagcgtcgttttgatt
gcaccgaatattatgtcgattgaacatactttagagaggatggatctggttcatgctttg
gtggagaaggtgaagatcgatctcgtcaccgggattgtgagacgtcatccgatctcagcg
aggaatctcgatttcgctgtgattaatccggcgtttctcgggagatgtagcaggtacgtt
tacgcggcgattggagatccgatgccgaagatctccggtgtggtgaagcttgatgtgtct
aaaggagatcgggatgattgtacggtggcccgtagaatgtacggttcaggttgttacggc
ggagaaccgtttttcgtagctagggatcctggtaatccggaggcggaggaggatgatggt
tatgtggtgacgtatgttcacgatgaagtgactggagaatcgaagtttctggtgatggac
gctaaatcgccggagcttgaaatcgtcgccgccgtgaggttgccgcgaagggttccgtac
ggattccatgggttatttgtcaaggaaagtgaccttaataagctttaa

DBGET integrated database retrieval system