KEGG   Arabidopsis thaliana (thale cress): AT4G33940
Entry
AT4G33940         CDS       T00041                                 
Name
(RefSeq) RING/U-box superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: zf-C3HC4 zf-RING_UBOX zf-C3HC4_4 zf-C3HC4_3 zf-C3HC4_2 zf-RING_5 zf-RING_2 PcfK BING4CT
Other DBs
NCBI-GeneID: 829539
NCBI-ProteinID: NP_001329714
TAIR: AT4G33940
UniProt: A0A1P8B8M3
Position
4:16266003..16267884
AA seq 199 aa
MSSLGSSKSLRDEMEVTTADVFPEVNAAAVTENLDRNELVLADGVVSAEERNIEPDNRGE
RKIESESPPEDDVCPICFGSFTVPCRGNCGHWYCGNCILQYWNYAAISRPCKCPMCVRHI
TKLSPEPSLQERQEQEVKEVLDKVRRYNRLFVGGLTGFVQKVHELPFLVKRMVWHMMDTD
VNNLYFHEVRIFAVKNILP
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtcttccttggggagcagcaaatccctgagggatgagatggaggtaacaaccgccgat
gtttttccggaggttaacgccgccgctgtgacggaaaatcttgatcggaacgagcttgtg
cttgctgacggagtcgtgtcggctgaggaaaggaatattgagccagacaatcgtggagag
aggaagatagagagcgagtcgcctccagaggatgatgtttgcccgatctgtttcggctcc
tttacggttccgtgtcgtggaaattgtggtcattggtattgcggaaattgcatcttgcag
tactggaactatgctgcaatatctaggccttgcaagtgtcccatgtgtgttaggcacatc
acgaagctgtcaccagaaccatctttgcaagagcgtcaggagcaagaggtgaaggaggtt
cttgataaagtccgtaggtataaccgtctctttgttggaggtctaactggctttgttcag
aaggtgcatgagcttccgtttctagtgaagagaatggtgtggcatatgatggatacagat
gtgaacaatctgtattttcacgaagtgcgcatctttgcagttaagaacatcttaccctga

DBGET integrated database retrieval system