KEGG   Arabidopsis thaliana (thale cress): AT5G03940
Entry
AT5G03940         CDS       T00041                                 
Symbol
CPSRP54
Name
(RefSeq) chloroplast signal recognition particle 54 kDa subunit
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03060  Protein export
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    AT5G03940 (CPSRP54)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ath02044]
    AT5G03940 (CPSRP54)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     AT5G03940 (CPSRP54)
Secretion system [BR:ath02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   AT5G03940 (CPSRP54)
  Eukaryotic Sec-SRP protein
   AT5G03940 (CPSRP54)
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N CbiA APS_kinase Zeta_toxin AAA_22 ArsA_ATPase AAA_17 ParA AAA_18 nSTAND3 NTPase_1 AAA_16 AAA_30 cobW CLP1_P AAA_31 6PF2K MeaB AAA ATP_bind_1 Thymidylate_kin ResIII AAA_25 AAA_33 KAP_NTPase KTI12 AAA_14 AAA_24
Other DBs
NCBI-GeneID: 830273
NCBI-ProteinID: NP_196014
TAIR: AT5G03940
UniProt: P37107 A0A178UD49
Structure
Position
5:complement(1060106..1063425)
AA seq 564 aa
MEALQFSSVNRVPCTLSCTGNRRIKAAFSSAFTGGTINSASLSSSRNLSTREIWSWVKSK
TVVGHGRYRRSQVRAEMFGQLTGGLEAAWSKLKGEEVLTKDNIAEPMRDIRRALLEADVS
LPVVRRFVQSVSDQAVGMGVIRGVKPDQQLVKIVHDELVKLMGGEVSELQFAKSGPTVIL
LAGLQGVGKTTVCAKLACYLKKQGKSCMLIAGDVYRPAAIDQLVILGEQVGVPVYTAGTD
VKPADIAKQGLKEAKKNNVDVVIMDTAGRLQIDKGMMDELKDVKKFLNPTEVLLVVDAMT
GQEAAALVTTFNVEIGITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGERMEDLEPF
YPDRMAGRILGMGDVLSFVEKATEVMRQEDAEDLQKKIMSAKFDFNDFLKQTRAVAKMGS
MTRVLGMIPGMGKVSPAQIREAEKNLLVMEAMIEVMTPEERERPELLAESPERRKRIAKD
SGKTEQQVSALVAQIFQMRVKMKNLMGVMEGGSIPALSGLEDALKAEQKAPPGTARRKRK
ADSRKKFVESASSKPGPRGFGSGN
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggaggctcttcaattttccagcgtgaatagagttccttgtactctgagctgtaccgga
aataggagaattaaggctgccttcagctctgcgttcaccggtggcaccatcaattcagct
tctctgtcctcctctaggaatctctccacgcgagagatatggagttgggtgaaatcgaag
actgttgttggccatggaagatacagaagaagccaagtgagagccgagatgtttggtcag
ttgactggtggcctcgaggctgcttggagcaaactcaaaggcgaagaggtcttgactaag
gacaatattgctgagccaatgcgggatatcagaagagctctcctggaagcagatgtgagt
ctcccagttgttagaaggtttgttcagtctgttagtgaccaagccgttggaatgggtgtc
attcgtggagtcaaaccagatcagcaattggtcaagattgtacatgatgagctagtgaaa
ttgatgggtggagaagtatctgagttacagtttgctaaatcaggtcctacagtaatattg
ttggctgggctccaaggagttggaaagacaacggtttgtgctaaactagcttgttaccta
aagaagcagggaaaatcttgcatgcttattgctggagatgtataccgacctgctgctatc
gatcaacttgtcattttaggtgaacaggttggtgtgccggtttatacagcagggactgat
gtaaaacctgcagatatagctaagcaaggtctaaaagaagctaaaaagaacaatgttgat
gtagttattatggatactgcagggaggcttcagatagataaaggcatgatggacgaatta
aaagacgtgaagaaatttctgaatccaacagaagtgttactagttgttgatgccatgact
ggacaagaagctgcagcactggtgacgacattcaatgtagagataggaattacaggagcc
attttgacaaagctagatggtgattcaagaggtggtgctgctttgagtgtcaaggaggta
tcaggaaaaccgattaaactggtaggacgtggagagcgaatggaggatcttgaacccttt
tatccagatcgaatggctggacgaattctaggaatgggagatgtgctttcatttgtagag
aaggcaacagaagttatgcgtcaagaagatgcagaagatctgcagaagaagataatgagt
gcaaagttcgacttcaacgattttctaaagcagactcgtgctgtagcgaaaatgggttcg
atgacacgagttcttggaatgattcccggaatggggaaagtgagtccagcacaaatccga
gaagcggaaaagaatcttttagtcatggaagcaatgattgaagtgatgacacccgaggaa
agagagagaccagagttactagcagaatctccagagagaagaaaaagaatcgctaaagat
tcaggaaagacagaacaacaggtgagcgcacttgtagcacaaatcttccaaatgagagtg
aaaatgaagaacttgatgggagtgatggaaggaggatcaattccagcattaagcggtctc
gaggacgcattgaaagcagaacaaaaggctccacctggaactgcaaggaggaagagaaag
gcagactcaaggaagaaatttgtagagtcagcatcaagcaagcctggtcctcgtggcttc
ggctctggtaactaa

DBGET integrated database retrieval system