KEGG   Arabidopsis thaliana (thale cress): AT5G15450
Entry
AT5G15450         CDS       T00041                                 
Symbol
CLPB3
Name
(RefSeq) casein lytic proteinase B3
  KO
K03695  ATP-dependent Clp protease ATP-binding subunit ClpB
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ath03110]
    AT5G15450 (CLPB3)
Chaperones and folding catalysts [BR:ath03110]
 Heat shock proteins
  HSP100
   AT5G15450 (CLPB3)
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 Clp_N ClpB_D2-small AAA AAA_5 Sigma54_activat AAA_16 AAA_22 nSTAND3 AAA_18 IstB_IS21 AAA_14 Zeta_toxin AAA_7 TniB AAA_28 Mg_chelatase NACHT AAA_25 AAA_24 ABC_tran DUF2229 PduV-EutP Torsin
Other DBs
NCBI-GeneID: 831398
NCBI-ProteinID: NP_568314
TAIR: AT5G15450
UniProt: Q9LF37 A0A654G1P4
Position
5:complement(5014212..5018347)
AA seq 968 aa
MATATTTATAAFSGVVSVGTETRRIYSFSHLQPSAAFPAKPSSFKSLKLKQSARLTRRLD
HRPFVVRCEASSSNGRLTQQEFTEMAWQSIVSSPDVAKENKQQIVETEHLMKALLEQKNG
LARRIFSKIGVDNTKVLEATEKFIQRQPKVYGDAAGSMLGRDLEALFQRARQFKKDLKDS
YVSVEHLVLAFADDKRFGKQLFKDFQISERSLKSAIESIRGKQSVIDQDPEGKYEALEKY
GKDLTAMAREGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIV
QGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTDSEGQIILFIDEIHTVV
GAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPTVE
DTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKME
ITSKPTALDELDRSVIKLEMERLSLTNDTDKASRERLNRIETELVLLKEKQAELTEQWEH
ERSVMSRLQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNSLQRQLNEAEKELNEYL
SSGKSMFREEVLGSDIAEIVSKWTGIPVSKLQQSERDKLLHLEEELHKRVVGQNPAVTAV
AEAIQRSRAGLSDPGRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEK
HAVSRLIGAPPGYVGYEEGGQLTETVRRRPYSVILFDEIEKAHGDVFNVFLQILDDGRVT
DSQGRTVSFTNTVIIMTSNVGSQFILNNTDDDANELSYETIKERVMNAARSIFRPEFMNR
VDEYIVFKPLDREQINRIVRLQLARVQKRIADRKMKINITDAAVDLLGSLGYDPNYGARP
VKRVIQQNIENELAKGILRGDFKEEDGILIDTEVTAFSNGQLPQQKLTFKKIESETADAE
QEEAAFSK
NT seq 2907 nt   +upstreamnt  +downstreamnt
atggcgacggctacgacgactgctacggcggcgtttagtggtgtagtcagtgtaggaacg
gagactcgaaggatttattcgttttctcatcttcaaccttctgcggcttttccggcgaag
cctagttccttcaaatctctcaaattaaagcagagcgcgaggctcacacggcggcttgat
catcggccgttcgttgtccgatgtgaagcttcttcttctaatggaaggcttacacagcaa
gaattcacagaaatggcgtggcaatcgatagtttcgtcaccagatgttgcaaaagagaat
aagcaacagattgtggagacagagcatctaatgaaagctcttttggagcagaagaatggt
ttagctcgtaggattttctctaagatcggtgtggataacacaaaggttctagaagcaaca
gagaagttcattcaacgccaaccaaaggtgtatggagatgctgctggttcgatgttgggg
cgtgatttggaagctctgttccagagagcaagacagtttaagaaagatttaaaggactct
tatgtgtcagtggagcatttggttcttgcttttgctgatgataagcggtttgggaaacag
ttgtttaaggattttcagatatcagagaggagcttgaaatctgcaattgaatccattaga
gggaaacaatcagtcattgaccaagatccggaaggcaagtatgaggcgttggagaagtat
ggaaaagacttgacagcaatggcaagagagggaaaactagatcctgtgataggtagagat
gacgagatccgaagatgcattcagattctctcaaggagaacaaagaacaaccctgtgttg
atcggtgaaccaggtgttggtaaaactgcaatttcagaaggacttgctcagaggattgtg
caaggagatgtacctcaagcattgatgaacagaaagttgatatctcttgatatgggtgct
ctcattgctggagcaaagtatcggggagaattcgaagacagactaaaagctgtgcttaag
gaagtcacagactcagaaggccaaatcattttgttcatcgatgagatccatacagttgtt
ggtgcaggtgcgactaatggggccatggatgctggtaatctgctgaaaccgatgctgggc
cgaggcgagttacgttgtatcggtgcaaccacgcttgatgaatataggaaatacatagag
aaagatccagccttggagcgtaggtttcaacaggtttatgttgatcaacctacggttgaa
gacacgatttctattctccgtggtttgcgggaaaggtatgaactacatcatggagttcgc
atctcagatagtgctctagtggaagctgctatcctctcagaccgttacatcagtggccgg
tttctacccgataaagcaattgacttggtcgatgaagcggcagccaaattgaaaatggaa
atcacttcgaaacctacagctcttgacgagcttgaccgttcggtaataaagcttgaaatg
gagaggctttcacttaccaatgatacagacaaagcttctagagagagattgaatcgaatt
gaaactgagttagtgctattaaaggagaaacaagctgagttaactgaacagtgggagcac
gagaggtctgttatgtcccgtcttcagtcgattaaagaggagattgatcgagtaaacctc
gagatccagcaggcggaacgtgaatacgatctcaaccgtgcagctgagctcaaatacgga
agcttaaactcattgcagcgacagcttaatgaagcagagaaagagctgaacgagtactta
agctctgggaaatctatgttcagagaagaggttttgggtagcgatatcgccgagattgtg
agtaaatggactggaatcccggtatcaaaacttcaacagtctgaacgagataagcttcta
catttggaagaagaattgcataaaagagtagtcggtcaaaacccagcagtgactgcggta
gctgaagcaatccaacgatcaagagctggtctttcggatccaggccgtcctatagctagt
ttcatgtttatgggaccaactggtgttggtaaaacagagctagccaaagcacttgcttct
tatatgttcaacactgaagaagctttagtgagaattgacatgagtgaatacatggagaag
catgcggtgtctaggctcattggagctccacctggatatgttggttacgaagaaggagga
cagttaacagaaacggttagaagaaggccttattcggtcattctatttgatgagattgag
aaagctcatggagatgtcttcaatgtgtttctccaaatcttggacgatgggcgagtcaca
gattctcaaggacgtacagtgagtttcaccaataccgtcattattatgacctcaaatgtt
ggttcgcagtttattctgaacaacacagatgatgatgctaatgagctctcttatgaaacg
attaaagagagagtgatgaatgctgcaaggtcaatctttcgtcctgaattcatgaatagg
gttgatgagtatatagttttcaaacctcttgaccgcgagcagatcaaccgcattgtccgg
ttacagctggcacgtgtgcagaagcgaattgcagacaggaaaatgaagataaacatcacg
gatgcagcagtcgatcttcttggaagcctagggtatgatccaaactatggagctagacct
gttaagcgtgtgatacagcaaaacattgagaatgagcttgctaagggtatcttgagagga
gatttcaaggaggaagatggcattttgatcgataccgaggtcacagcgttctccaatggc
cagttacctcagcaaaagctcacattcaagaagattgagtcagaaacagcagatgctgaa
caagaagaagcagctttctcaaaatag

DBGET integrated database retrieval system