KEGG   Arabidopsis thaliana (thale cress): AT5G51070
Entry
AT5G51070         CDS       T00041                                 
Symbol
ERD1
Name
(RefSeq) Clp ATPase
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 ClpB_D2-small Clp_N AAA AAA_5 AAA_16 AAA_22 Sigma54_activat nSTAND3 IstB_IS21 AAA_7 AAA_14 AAA_18 NACHT AAA_25 Zeta_toxin Torsin AAA_33 T2SSE AAA_28
Other DBs
NCBI-GeneID: 835180
NCBI-ProteinID: NP_568750
TAIR: AT5G51070
UniProt: P42762 A0A178UDT2
Position
5:20764096..20768764
AA seq 945 aa
MEVLSTSSPLTLHSHRLLSASSSSSHVTSIAASSLSSFASSYLGISLSNRTIHRFSTTPT
NLRRFPQRKRKKFTPISAVFERFTERAIRAIIFSQKEAKSLGKDMVYTQHLLLGLIAEDR
DPQGFLGSGITIDKAREAVWSIWDEANSDSKQEEASSTSYSKSTDMPFSISTKRVFEAAV
EYSRTMDCQYIAPEHIAVGLFTVDDGSAGRVLKRLGANMNLLTAAALTRLKGEIAKDGRE
PSSSSKGSFESPPSGRIAGSGPGGKKAKNVLEQFCVDLTARASEGLIDPVIGREKEVQRV
IQILCRRTKNNPILLGEAGVGKTAIAEGLAISIAEASAPGFLLTKRIMSLDIGLLMAGAK
ERGELEARVTALISEVKKSGKVILFIDEVHTLIGSGTVGRGNKGSGLDIANLLKPSLGRG
ELQCIASTTLDEFRSQFEKDKALARRFQPVLINEPSEEDAVKILLGLREKYEAHHNCKYT
MEAIDAAVYLSSRYIADRFLPDKAIDLIDEAGSRARIEAFRKKKEDAICILSKPPNDYWQ
EIKTVQAMHEVVLSSRQKQDDGDAISDESGELVEESSLPPAAGDDEPILVGPDDIAAVAS
VWSGIPVQQITADERMLLMSLEDQLRGRVVGQDEAVAAISRAVKRSRVGLKDPDRPIAAM
LFCGPTGVGKTELTKALAANYFGSEESMLRLDMSEYMERHTVSKLIGSPPGYVGFEEGGM
LTEAIRRRPFTVVLFDEIEKAHPDIFNILLQLFEDGHLTDSQGRRVSFKNALIIMTSNVG
SLAIAKGRHGSIGFILDDDEEAASYTGMKALVVEELKNYFRPELLNRIDEIVIFRQLEKA
QMMEILNLMLQDLKSRLVALGVGLEVSEPVKELICKQGYDPAYGARPLRRTVTEIVEDPL
SEAFLAGSFKPGDTAFVVLDDTGNPSVRTKPDSSTIRVTDKTSIA
NT seq 2838 nt   +upstreamnt  +downstreamnt
atggaggtgttatctacttcctcacctctaacgcttcactcccaccgactcctctctgct
tcttcttcttcttcacatgtcacctccatcgccgcttcttcactttcttcattcgcttct
tcatatctcggaatctccctttctaaccgcacgatccaccgcttctccacaactccgacg
aacttaagacgatttcctcaaagaaaacggaagaaattcactccgatttcagcggttttc
gaacggttcaccgaacgagcgatcagagctataatcttctctcagaaggaagctaaatcg
ttgggaaaagatatggtttacacgcagcatcttctcttaggtttgatcgctgaggatcgt
gatcctcaaggcttccttggatccggtatcaccatcgacaaggctcgtgaagctgtttgg
agtatttgggacgaagctaattccgattcgaaacaggaggaagcttcttctacttcgtat
tcaaaatcgacggacatgcctttctctatcagcacgaaacgagtctttgaagctgcggtt
gagtactctaggactatggattgtcaatatatcgcaccggagcatatagccgttggactc
ttcaccgttgatgatggtagcgccggcagagttctcaagagattgggagcaaatatgaat
ttgctcacagctgcagcacttacaagacttaaaggagagattgctaaagatggaagagag
ccatcttcttcatctaaagggagcttcgagtctcctcctagtggtcgaattgctggttct
ggacctggtggaaaaaaagcgaaaaatgtactggaacagttctgtgtggatctgacagca
cgtgctagtgagggtcttattgatcctgttattggtcgggaaaaagaggttcaaagagtt
atccagatactttgccgcagaactaaaaacaacccaattcttcttggtgaagctggtgtt
gggaagactgccattgctgaaggactagcgattagtattgcagaagccagtgctcctgga
tttctcttgacgaaacgcatcatgtccctggatataggattgctaatggccggtgcaaaa
gaaaggggagagctggaggctcgagtcactgctttgataagcgaggttaaaaaatcaggt
aaggtcattctcttcatagatgaagtgcatacacttattgggtctggcacagttggaaga
gggaacaaagggtctgggcttgacattgctaacctcttgaaaccatcacttggaaggggt
gaacttcagtgcattgcatccacaacccttgacgaatttaggagtcagtttgagaaggac
aaagcccttgcaaggagatttcagccagtgttgattaacgagccaagcgaggaagatgcg
gtgaagattttgttgggccttcgtgaaaaatatgaagcccatcacaattgcaaatatact
atggaagccatagatgctgcagtgtacctttcatcacgatatatcgctgatagatttctt
ccagataaagctattgatctcattgacgaggcaggaagcagagctcgtattgaagctttt
aggaagaaaaaggaggatgcaatctgtatcctatcgaagccacctaatgattactggcaa
gagatcaaaacagttcaggccatgcacgaagtggttctctcaagcaggcaaaagcaggat
gacggtgatgccatttcagatgagtctggtgaactagttgaagagtcttctttgccacct
gcagcaggcgacgatgagcctatactggtgggacctgatgatattgcagccgttgcatcg
gtttggtctggaattccagttcagcagatcactgcagatgaaagaatgcttcttatgagt
ctagaagatcagcttagaggcagagttgttggtcaagatgaggcggtagctgccatatct
agagctgtgaagaggtcccgggttggcttaaaagatcccgaccgtccaattgctgctatg
cttttctgtggaccaacaggggttggaaaaacggagcttacaaaagctctggcagcaaat
tattttggctcggaagaatccatgctgagattggacatgagtgaatacatggagcgtcat
actgtgagcaagctgataggctctcctcctggttatgttggctttgaagaaggtggaatg
cttacagaagctatcaggagacgtccttttacagtggttttgttcgatgaaatagagaaa
gcacatccggatatcttcaatattcttctccagctgttcgaagatggccatctaactgat
tcacagggaaggagagtatcttttaagaacgcattgatcataatgacctctaatgtcgga
tcattggccattgcaaagggaagacatggttcaatagggtttatcctcgatgatgatgaa
gaggcagcatcttataccggaatgaaagctttggtagtcgaagaactcaagaactatttc
cgtccagagttgttgaaccgaatagacgaaatcgtcattttccgacagctagagaaggct
cagatgatggagatcttgaacctgatgctacaagacttgaagtcgaggctcgtggcactc
ggagttggtttagaggtgtctgaacccgtcaaggagctcatatgcaaacaaggctatgat
ccagcttacggtgcacgaccactccggagaactgtcacagagattgttgaagatccactc
agtgaagcctttcttgccgggagcttcaagcctggtgatacggcttttgtagttcttgat
gataccggaaacccatcggttcggaccaaaccagattcttccactatacgagttacagac
aaaacatcgatcgcatag

DBGET integrated database retrieval system