KEGG   Agrobacterium fabrum: Atu3521
Entry
Atu3521           CDS       T00070                                 
Name
(GenBank) permease
Organism
atu  Agrobacterium fabrum
SSDB
Motif
Pfam: EamA Beta-prism_lec
Other DBs
NCBI-ProteinID: AAK89875
UniProt: A9CFB8
Position
linear:570113..571006
AA seq 297 aa
MAPRDLAAYIFLAITWGVSFLLLLHVVAAFGWIGAVTLRSLITAVALYLIARAARRKLAF
SASWRAFAIVGATTVAGQLIGLSYATPQIGTAMAAILVATIPLFSMLISQMWGLERLTRQ
GIAGLVIGFAGIVLLVGFPAVPVTSGFIIGCAAAVAACICAAYGSNFASLHLKGVGSWEI
TIGSFLTGGLMTLPLLFAVPLPGTPDLVDYGYLLIQAVVMSGLTYITYFKLVSSIGATKA
ISVEFAVTVVAVLVGALVLDEPLSLPQLFGAGIIIFGCALVLDLLPKKKAPPTPSGA
NT seq 894 nt   +upstreamnt  +downstreamnt
atggcccctcgcgatcttgccgcctatatttttctcgcgattacgtggggcgtgtctttc
ctgctgcttctgcatgtcgtcgccgccttcggctggattggcgcggtcacgcttcgctcg
ctcataaccgctgtcgccctttatctcattgcgcgggcggcccgccggaagctggcattt
tccgccagctggcgcgctttcgcaatcgtcggcgcaacgacggtcgccgggcaactgatc
ggcctttcctatgcgacgccacagatcggcaccgcgatggcagccatattggtggcgacc
attccgcttttctcaatgctcatctcgcagatgtggggtctggaacgcctgacgcggcag
ggcattgcgggtctcgtcatcggctttgccggtatcgttctgcttgtcggctttcccgct
gttcccgtcacttcaggctttatcatcggctgtgctgccgctgtcgccgcctgcatctgt
gcggcctatggcagtaattttgcgagcctgcacctcaaaggagttggatcctgggaaatc
accatcggttccttcctgacaggtggcctgatgaccctgccgcttcttttcgcggtgccc
ttgcccggaacacctgatctcgttgactacggttatcttctgatacaggcggtcgtcatg
agcggcctgacctatatcacctatttcaagctggtctcctcaatcggcgcaacgaaggcg
atcagcgtggaatttgccgtcaccgtcgtggcggtgcttgtcggcgccctggtgctcgat
gaacccctgtcgcttccccagcttttcggcgccggcatcatcattttcggctgcgcgctg
gtgctcgaccttctgcccaagaaaaaggcgccacctaccccttcgggcgcgtga

DBGET integrated database retrieval system