KEGG   Azorhizobium caulinodans: AZC_3861
Entry
AZC_3861          CDS       T00609                                 
Symbol
trbE
Name
(GenBank) ATPase precursor
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
azc  Azorhizobium caulinodans
Pathway
azc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:azc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AZC_3861 (trbE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azc02044]
    AZC_3861 (trbE)
Enzymes [BR:azc01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     AZC_3861 (trbE)
Secretion system [BR:azc02044]
 Type IV secretion system
  Trb secretion system protein
   AZC_3861 (trbE)
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB AAA_22 AAA_29 HerA_C TraG-D_C ABC_tran AAA_16 FtsK_SpoIIIE DUF87 RPN1_C
Other DBs
NCBI-ProteinID: BAF89859
RhizoBase: AZC_3861
UniProt: A8IPD3
Position
4411982..4414420
AA seq 812 aa
MMNLAEYRRDNRRLADFLPWAALVAPGIVLNKDGSFQRTARFRGPDLDSAVPAELVAVAG
RLNNAFRRLGSGWAIFVEAQRHAAATYPASAFPDAASALVDAERRAEFEQAGSHFESSYV
LTFTFLPPAEDAARTEGWLYEGRDQAGLDPHETLRGFADRTDRILNLIDAFMPECRWLDD
DEMLTYLHGCVSTQRHRVRVPETPTYLDALLADQPLTGGLEPRLGDQHLRVLTITGFPTV
TTPGLLDELNRLAFPYRWSTRAILLDKTDAVRLLTKIRRQWFAKRKSIAAILKEVMTNEA
SVLVDSDAANKAEDADLALQELGADHAGIAYVTATVTVWDADPRIADEKLRRVEKVIQGR
DFTVMTETINAVDAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGDSADAHFNAPP
LLFGKTEGSTPFRFCLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYAGAQVFAFDFGG
SIRAAALACGADWHDLGGGLSEGSAETVALQPLARIDEAVEHAWAADWLNAILTREGVHI
TPQMKEHIWTALTSLASAPVEERTLTGLCVLLQSNDLKQALRPYCLGGAWGRLLDAETEH
LGSATVQVFETEGLIGTEAAPAVLAYLFHRIEDRLDGSPTLIIIDEGWLALDDEAFAGQL
REWLKTLRKKNASVIFATQSLSDIDGSAIAPAIIESCPTRLLLPNERAIEPQITAIYRRF
GLNDRQIEILARATPKRDYYCQSRRGNRLFELGLSEVALALCAASSKTDQQAIGRIFAAY
GRDGFLDAWLRHRGLGWAADLLPNLTNLETQP
NT seq 2439 nt   +upstreamnt  +downstreamnt
atgatgaacctcgccgagtatcgccgcgataaccggcgccttgccgatttcctgccctgg
gcagcgctcgtcgcgccgggcatcgtcctgaacaaggatggttcgttccagcggacagcg
cgctttcgcggaccggacctcgacagcgccgttcccgccgagctcgtcgcggtagcaggg
cggctgaacaacgcctttcgtcgccttggctcgggatgggcgatcttcgtggaggcgcag
cgccatgcggccgcgacctacccggcgagcgcctttcccgatgccgcctccgctctggtc
gatgccgagcggcgggccgaattcgagcaggcgggcagccatttcgagtcgagctacgtc
ctgaccttcaccttcctgccgccggccgaggatgccgcccgcaccgaaggctggctctat
gaagggcgggaccaggcaggccttgatccccatgagacgttgcgcggcttcgccgaccga
actgatcggatcctcaacctcatcgatgccttcatgccggaatgccgctggctggacgac
gacgagatgctgacctatctgcatggttgtgtctcgacacagcggcaccgtgtccgcgtg
ccggagacgccgacctatctcgacgcgctgctggccgatcagccgctcaccggcgggctg
gagccgcgcctcggcgatcagcacctacgtgtgctgaccatcaccggctttcccacggtg
acgacgcccggcctgctcgatgagctgaaccggctcgcctttccttatcgctggtcgacc
cgcgccatccttctcgacaagacggatgcggtccggctgctcaccaagatccgccgccaa
tggttcgccaagcgcaaatccatcgccgccatcctgaaggaggtcatgaccaatgaggcc
tccgtcctcgtggactcggatgccgcgaacaaggctgaagatgccgacctcgccctgcag
gagctcggcgcggaccatgccggcatcgcctatgtcaccgcgacggtgacggtgtgggat
gccgatccgcgcatcgccgacgagaaactgcgacgggtcgagaaggtcatccagggccgc
gacttcacggtgatgaccgagaccatcaatgccgtcgatgcctggctcggcagcttgccc
ggccacgtctatgccaatgtccgccagccgccgatctcgacgctcaatctcgcccatatg
attccgctgtcagcggtgtgggccggcgacagtgccgacgcgcatttcaatgccccgccg
ctcctgttcggcaagaccgagggctcgaccccgttccggttctgcctccatgtcggcgat
gtcggccacaccctcgtcgtcggcccgaccggcgccggcaaatccgtgctgctggcgctg
atggcgctgcagtttcggcgctacgccggtgcccaggtgtttgcctttgatttcggcggc
tcgatccgggcggcggcgctcgcttgtggggcggactggcacgatctcggtggcgggctc
agcgaggggagcgcggagactgtcgcgctccagccgcttgcgcgcatcgatgaagctgtg
gaacacgcctgggccgccgactggctgaacgccatcctcacccgcgaaggcgtccatatc
acgccgcagatgaaggaacatatctggacggcgctgacatcgctcgcctcggcgccggtc
gaggaacgcaccctcaccggcctctgcgtcctgcttcagtccaacgacctgaagcaggca
ttgcgtccctactgcctgggcggcgcctggggccggctgctcgacgccgagaccgagcat
ctgggctccgccaccgtccaggttttcgagactgaggggttgatcggtacggaggccgcg
cctgcggtgctcgcctatctgttccaccggatcgaggatcggctcgatggatcgccgacc
cttatcatcatcgatgaaggctggctggcgctggacgacgaggccttcgcgggccaactg
cgcgaatggctgaagacgctgcgcaagaagaacgccagcgtcattttcgccacgcagtcg
ctctccgacatcgacggctcggcgatcgcacccgccatcatcgagagctgcccgacacgc
cttctgctccccaatgagcgggccatcgagccgcagatcaccgccatctatcgccgcttc
ggcctgaacgatcggcagatcgagatcctcgcgcgggcgaccccgaagcgcgactactat
tgccagtcgcggcgcggcaaccggctgttcgagctcggcctcagtgaggtcgcgctggcg
ctgtgcgcggcgtcctcgaagacggaccagcaggccatcggcaggatattcgccgcgtac
ggtcgcgacggcttcctggacgcttggctgcgtcatcgcggcctcggctgggccgccgac
ctccttcccaacctcaccaatttggagacgcagccatga

DBGET integrated database retrieval system