KEGG   Bradyrhizobium sp. BTAi1: BBta_3368
Entry
BBta_3368         CDS       T00528                                 
Name
(GenBank) putative conjugal transfer protein trbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBta_3368
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbt02044]
    BBta_3368
Secretion system [BR:bbt02044]
 Type IV secretion system
  Trb secretion system protein
   BBta_3368
SSDB
Motif
Pfam: DUF4141 CoV_Methyltr_2 DUF5929 NBD94 Mucin15 Syntaxin_2 Mod_r
Other DBs
NCBI-ProteinID: ABQ35467
RhizoBase: BBta_3368
UniProt: A5EH23
Position
3525487..3526224
AA seq 245 aa
MTDPRGLARGAAAAVVIWAASTCMSSAQLVVFDPNNYAQNVLTAVRELQQINNQIISLQN
QAQMLINQAKNLASLPYSSLAQLQQSIQRTQQLLKEAQRLAYDVQQIDKAFATTYAPASS
SQSSQALVESAQARWQTSVAALQDALKVQAGVVGNLNTVKTQSSALIAASQGASGALQVT
QAGNQILALQAQQLADLTASVAAQGRAAMLDAAQRAAAQDQGREQLKRFLTPGQGYQPSN
VRMFH
NT seq 738 nt   +upstreamnt  +downstreamnt
atgacggatcctcgtggtctcgcccgtggcgctgcggcagccgtcgtcatctgggcggcg
tcgacctgcatgtcgtcggcgcagctggtcgtgttcgatccgaacaattacgcccagaac
gtcctgaccgccgtgcgcgagctgcagcagatcaacaatcaaatcatctcgctgcagaac
caggcgcagatgctgatcaaccaggcgaagaatcttgcgagtctgccgtattcgtcgctg
gcgcagttgcagcagtcgatccagcgcactcagcagctgctcaaggaggcccagcgcctc
gcctatgatgtgcagcagatcgacaaggcgttcgcgaccacctatgcgccggcgagcagc
agccaatcgagtcaggcgctggtggagagtgcgcaggcgcgctggcagacttcggtggcg
gcgctgcaggatgcgctcaaggtccaagcgggcgtcgtcggcaatctcaacacggtcaag
acccagtcctccgcgctcattgcggcgagccaaggcgcgagcggggctttgcaggtcacc
caggccggcaaccagatccttgcgctgcaggctcagcaattggccgatctcaccgcgagc
gtggccgcgcagggccgggccgcgatgctggatgctgcccagcgcgccgccgctcaggat
cagggtcgcgagcagctcaagcgcttcctgacgccaggtcaaggctaccagccctccaac
gtacggatgttccattga

DBGET integrated database retrieval system