KEGG   Bacillus clausii: ABC3742
Entry
ABC3742           CDS       T00228                                 

Gene name
pucC
Definition
(GenBank) xanthine dehydrogenase subunit C
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
bcl  Bacillus clausii
Pathway
bcl00230  Purine metabolism
bcl01100  Metabolic pathways
bcl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ABC3742 (pucC)
Enzymes [BR:bcl01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ABC3742 (pucC)
SSDB
Motif
Pfam: FAD_binding_5 CO_deh_flav_C
Other DBs
NCBI-ProteinID: BAD66274
UniProt: Q5WBI6
Position
complement(3901712..3902605)
AA seq 297 aa
MGLPPFAEVEMNQYPPVSMPTTVEQAWAEAQKPGSTFVAGGTIVQMRREQGFDMGNRFVS
LEQIRRLKTMIETDTAIYIGAFATLAECLNSKMVAQEQPLLVQALASIGAPAVRNRATLG
GNIVYGKGDSIPALLVLEANVVLYHDGLATMPLSEWLQQKPNALLTEVEIGKWPDMTQRF
WLYEKVGRRETFTASLVTVAGVAVLDNDQTIKELKLAVGGGEMVPHRLLEIEQRLIGKPL
TNELLADVYQFIKQTGTLVGTPFATETYLRMVLANRIVSFVDGLRGGRGDGKTNDSL
NT seq 894 nt   +upstreamnt  +downstreamnt
atgggcttgccgccatttgcagaagtggaaatgaaccagtatccgcctgtgtctatgcca
acgacagtcgagcaagcatgggcggaggcgcaaaagccaggctcgaccttcgtcgcgggt
ggaacgattgtacaaatgcggagggaacaaggatttgacatgggcaaccgctttgtttct
ttagagcaaatccgtcgtttgaaaacaatgatagagaccgataccgctatctatattggt
gcttttgcgacgctagccgaatgtttgaatagcaagatggtcgcacaagaacagcccctg
ctagtgcaggcgcttgcttctattggcgctcctgcagtgcgaaatcgcgctacacttggg
ggcaacatcgtatacggcaaaggcgattccattccagcgctgcttgtgctggaagcgaac
gtcgttttatatcacgatggattggcgacgatgccattgtcggaatggcttcagcaaaag
ccaaacgcccttttaacagaagtggagattggcaaatggccagacatgacgcaacgtttc
tggctatatgaaaaggtcgggcgccgtgaaacatttacggcatcattagtgacggttgct
ggcgttgcagtccttgataacgatcaaaccattaaagaactgaagttagccgtcggtggc
ggcgaaatggtgccgcaccgactgcttgagatagaacagcgccttatcgggaagccactt
acgaatgagttgcttgccgacgtctaccagtttattaagcaaacgggcacacttgttggc
acgccctttgcgacggaaacgtatttgcggatggtgctcgcaaaccggattgtctcgttc
gtcgatggcttgagagggggaagaggagatggaaaaacgaacgattcgttatga

DBGET integrated database retrieval system