KEGG   Baudoinia panamericana: BAUCODRAFT_476493
Entry
BAUCODRAFT_476493 CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00910  Nitrogen metabolism
bcom01100  Metabolic pathways
Module
bcom_M00531  Assimilatory nitrate reduction, nitrate => ammonia
bcom_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BAUCODRAFT_476493
Enzymes [BR:bcom01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     BAUCODRAFT_476493
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Rieske_2 Pyr_redox Rieske Fer2_BFD NIR_SIR_ferr Pyr_redox_3 Amino_oxidase Rubredoxin_C K_oxygenase
Other DBs
NCBI-GeneID: 19114722
NCBI-ProteinID: XP_007676534
JGI: Bauco1_476493
UniProt: M2NBF3
Position
Unknown
AA seq 1118 aa
MSNSEWNDAEANVLPEKVAKMADEGEIPEPTKRKRIVVVGLGMVGIAFIEKLMKLDVKRR
EYDIIVIGEEPHLAYNRVGLTSFFQHREVENLYLNPASWYASMPEGSLNYHLNTMVTSID
SEKKTVETSNGDTVPYDVLVLATGSDAVLPKHTPGHNAKGVFVYRTIEDLQKLIAFSSTK
KGTSGAVVGGGLLGLEAAKAMMDLEEFSKVKLIERNRWVLSRQLDADAGNMVVEQVRALG
LDVLLSKRVGRINTDEENNVCGVTFEDGETMDCSCICFAIGIKPRDELARKSGITCADRG
GGIIIGKDLSTSAPDVYAIGECASWESQTYGLIAPGVEMADILAFNLTQAKAHSPRSFKQ
PDLSTKLKLLGVEVASFGDFFADRDGPKNMPSRRHAAKKEGTTEAQETVKGLTEGPPPSP
VKALTYKDPFQQVYKKYLFTMDGKYLLGGMMIGDTKDYVKLVPLVKNQKQLEISPSELII
GAKKGDDEGADDLEDDTQVCSCHNVLKGDIANAVKDGTCKSIGDVKSCTKAGTGCGGCMP
LVQTIFNKAMQSMGQEVKNNLCPHFDYSRADLFNIIYVKKIKSFEEIMKQCGKEPESLGC
EACKPTIGSILASLYNQHIIDKERRGLQDTNDRFLANIQRNGTFSVIPRVSGGEITADKL
IVIGTVAKKYGLYCKITGGQRIDLFGARKHDLPKIWQELIDGGMESGHAYAKSLRTVKTC
VGTTWCRFGIGDSVGMGVRLEERYKSIRSPHKIKGGVSGCVRECAEAQNKDFGLIATEKG
YNIFVGGNGGAKPRHSELLAKDVPPDDVVTILDRYLSFYIRTADKLMRTARWVENLPGGI
KYLREVILEDKLGICADLEQQMEDLVGSFFCEWTEVLKSPERLKLFSQFGNTDENVDSMD
KVEDRGQERPAYWPKDSVTEDFRGTQWSELTWQPLAKSEQFTDAPTGSSLAVKRGDTQLA
IFKVKGQYYATQQMCPHKRAFVLSDGLIGDDMKTDKLWVSCPYHKRNYELKGADAGKCGN
DESVNIATFPVEARDDGMVYVKLPPVQELDGVLGTEKWKIRKEETEEHSPFEALDEKLKK
MKGRKSMQASHLPNGLGEKAKADAILAGAERGANGMDW
NT seq 3357 nt   +upstreamnt  +downstreamnt
atgagtaacagcgagtggaacgatgccgaggccaatgtgttgccggagaaggttgcgaag
atggcagatgaaggtgaaatacctgagccgacgaaacggaagaggattgtcgtcgtaggg
ctggggatggtgggcatagctttcattgaaaagctcatgaagcttgatgtgaagagacga
gagtacgacatcatagtgattggcgaggagcctcatctcgcatacaacagagttggcttg
acgagcttcttccagcatcgcgaggtagagaatctgtacctcaatcccgcgagctggtat
gcctcaatgccggagggtagcctcaactaccacctgaatacaatggtgacctccattgac
tccgagaagaagacggtagagacttcgaacggcgatacagtaccgtacgacgtgcttgtg
ttggccactggatctgatgccgtactgccgaagcacacgccaggtcacaatgcaaaaggt
gtctttgtgtacaggaccattgaagatctgcaaaagcttatcgcattctcctcgaccaag
aaaggcacatctggcgctgtggtcggaggtggcttactcggtctcgaagcagcgaaggcc
atgatggatctcgaagagttcagcaaggtcaagcttattgagcgcaacagatgggttctc
agccggcagctggatgctgatgccggcaacatggtcgtggagcaggtgcgtgctcttgga
ctcgacgtcctccttagcaagcgcgttgggcggatcaacaccgacgaggagaacaacgtc
tgcggcgtcacattcgaagacggtgaaacgatggactgcagctgtatctgcttcgcaatt
ggcatcaagccgcgcgatgagctagcaaggaagtcgggcattacgtgtgctgatcgtgga
ggaggtattatcattggcaaggacctttcgacttccgcgcctgacgtgtacgcgatcggt
gaatgtgctagctgggagagtcagacgtacggcctcatcgcacctggggtggagatggcg
gacatcttagcgttcaacctgacgcaggcgaaggcgcactcgcctcgctccttcaagcag
ccagacctcagcaccaagcttaagttgctcggtgtggaagtggcgagcttcggtgatttc
tttgcggaccgtgacggaccaaagaacatgcctagcagacggcacgcggcaaagaaggaa
gggacgacggaggcccaagagacggtcaaaggcctcaccgaaggtccaccgccttcgcct
gtgaaggctctgacttacaaagacccgttccagcaggtctacaagaagtatctctttacg
atggacggcaagtacttacttggcggcatgatgatcggtgatacgaaagactacgtcaag
ctcgtgccattggtgaagaaccagaagcagctggaaatctcaccaagcgagttgatcatc
ggagccaagaaaggagacgatgaaggtgctgacgatctcgaggatgacacgcaagtctgc
tcctgccacaatgtgctcaaaggcgacattgcgaacgctgtcaaggacggcacctgcaag
tccatcggcgacgtgaagtcttgcacgaaagctgggacgggatgcggaggctgcatgccg
cttgtccaaaccatcttcaacaaggctatgcagtcgatgggtcaagaggtgaagaacaac
ctctgcccacacttcgactactctcgagccgaccttttcaacattatttacgtcaagaag
atcaagagcttcgaggagatcatgaagcaatgcgggaaagagcccgagtcactaggttgt
gaagcctgcaagcctacgatagggtccatcttggcatcgttgtacaatcagcacatcatt
gacaaggaacggagaggactgcaagatacgaatgaccgcttccttgccaacatccagcga
aacggcaccttctctgttattcctagagtgtcgggcggtgagatcactgccgacaagctc
atcgtcattggcactgtggcgaagaagtacggcttgtactgcaagattaccggcggccaa
cgtatcgacttgtttggcgcgagaaagcacgacctaccgaagatctggcaagagctcatc
gatggcggcatggagtccgggcacgcatacgccaaatccctccggaccgtcaaaacctgc
gtgggcacaacttggtgtcgtttcggcatcggtgacagtgtcggcatgggtgtcaggcta
gaggagcgctacaagagtatccggtctccgcacaagatcaagggcggcgtttccggttgc
gtgagagaatgcgcagaggcccagaataaggacttcgggctcatcgctaccgagaaaggt
tacaacatcttcgtcggcggcaatggtggagccaagccgagacattcggaacttctggca
aaggacgtgccacccgacgatgtggttaccattcttgatcgttacctttccttctacatc
cggactgctgacaagctgatgcggacggcaagatgggttgagaatctaccgggcggtatc
aagtatctccgcgaagtcattcttgaagataagctcggaatctgcgccgacctcgaacag
cagatggaagacctcgttgggtccttcttctgcgaatggacggaggtgctcaagtcacca
gaacgattgaagctcttctcgcaattcggtaacactgacgagaatgtggactcgatggat
aaggtggaagacaggggccaagaacgcccagcgtactggccaaaggactccgtgactgaa
gacttccgcggcacccagtggtctgaactgacctggcaacctttagcgaagtcggaacag
ttcactgacgcaccaacgggatcgagcttggcggtcaagcgtggcgacactcagctggcc
atcttcaaggtcaaaggccagtactatgctacgcagcaaatgtgccctcacaagcgcgcc
ttcgtccttagcgacggtctgattggagacgacatgaagacggacaaactttgggtcagc
tgtccgtatcacaagcggaactacgagctcaagggcgcggatgcaggcaaatgcggcaac
gacgagagcgtcaacattgctactttccccgttgaagcgagggatgatggtatggtatac
gtgaagctcccgccggttcaggagttagatggcgtactcggcacggagaagtggaagatc
cggaaagaggagacggaggagcatagcccatttgaagcgcttgacgagaagctgaagaag
atgaagggccggaagagtatgcaagcaagccatcttcccaatggtctgggcgagaaggcg
aaggctgatgccattttggcgggcgccgaaaggggtgcaaacggaatggactggtaa

DBGET integrated database retrieval system