KEGG   Burkholderia glumae BGR1: bglu_1g03910
Entry
bglu_1g03910      CDS       T00905                                 

Definition
(GenBank) putative type VI secretion system protein TssD
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    bglu_1g03910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgl02044]
    bglu_1g03910
Secretion system [BR:bgl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bglu_1g03910
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACR27590
UniProt: C5AA67
Position
1:403385..403888
AA seq 167 aa
MLDIYLNFGNPAIKGESQDKDHSGWIELKSWDWSVTQPRSATSSTSGGHTAERCEHSDMV
FTKELDMASPLLYQHASGGTTFDEVSIDFMRSDGDGKRVKYLEIKLKYVIISSVTPSVQK
EGLPVEQFSLKYAAVQWKQTKQNIGGNQGGNTQGAWSLTKNDKTYAV
NT seq 504 nt   +upstreamnt  +downstreamnt
atgttagatatctatctcaatttcggtaacccggccatcaagggcgagtcgcaggacaag
gaccactcgggctggattgaactcaagtcatgggactggtcggtcacgcagccgcgctcg
gccacctcgtccacctcgggcggccacaccgccgagcgctgcgaacacagcgacatggtg
ttcacgaaagagctcgacatggcgagcccgctgctgtaccagcacgcatcgggcggcacg
accttcgacgaagtgtcgatcgacttcatgcgttcggacggcgacggcaagcgcgtcaag
tacctcgagatcaagctcaagtacgtgatcatctcgagcgtcacgccgagcgtgcagaag
gaaggcctgccggtcgagcagttctcgctgaagtacgctgcggtgcagtggaagcagacc
aagcagaacatcggcggcaaccagggcggcaacacccagggcgcctggagcctcacgaag
aacgacaagacctacgcggtctga

DBGET integrated database retrieval system