KEGG   Brevibacterium linens BS258: A2T55_04305Help
Entry
A2T55_04305       CDS       T04319                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
bly  Brevibacterium linens BS258
Pathway
bly00250  Alanine, aspartate and glutamate metabolism
bly00330  Arginine and proline metabolism
bly01100  Metabolic pathways
bly01110  Biosynthesis of secondary metabolites
bly01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bly00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A2T55_04305
   00330 Arginine and proline metabolism
    A2T55_04305
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bly03000]
    A2T55_04305
Enzymes [BR:bly01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     A2T55_04305
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     A2T55_04305
Transcription factors [BR:bly03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    A2T55_04305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh
Motif
Other DBs
NCBI-ProteinID: AMT95323
UniProt: A0A144MQI1
Position
complement(998742..1002146)
Genome map
AA seq 1134 aa AA seqDB search
MHTETDLATLTAQSIDTVRRWLRVSTSMTTAKNPAAERLSAVLSDDNGLDFTVGFVDRVV
RTDDVHAAADALTEVGKLAPETMSYLDRAQIKAGAALAKIAPQVVVPAARTRLRQMVGHM
VVDARDKQFGKTVAALTADSHRLNINLLGEAVLGDGEADNHLEQTHRLLARDDVDYVSVK
VSSVASQISMWAFDETVDYVVDRLRPLYQQAAKAPTGAKFVNLDMEEYQDLELTIAVFTR
LLSEPEFKDLEAGIVIQAYQPDALGAVQRLSEFASRRVENGGVGIKVRLVKGANLAMETV
HAEIAGWPATTCDSKQSTDANYKRVLHWLFTPERMKGLRIGVAGHNLFDIAFAHHLSVER
SVTDRVEFEMLQGMASEQAAAVTEDVGDLLLYVPAVHPKEFDVAISYLVRRLEENSASEN
FMSGIFDLANGNDVFKREADRFTASVNQLESILETEGETAPAPNRHQNRSTETLGETVVP
TQFFNEPDTDPALPANQEWVRNIIAEATAPGYLDDRPNAPKVGSTDELDEMIARGRAAAA
DWRALGAAGRAEVLHRAADIFAARRGEFIAVEAAEVGKMPSQSDPEVSEAIDFIRYYALN
SLELDNLDGAEFTPDEMVVITPPWNFPVAIPTGGTVATLAAGSAVIHKPSKPTPHCSALI
IDCLWQAGVPKDVLQLCAPIERELGQHLVSHPDVDRVILTGASETAAMFKSFRPELHVNA
ETSGKNALVITPAADRDLAMADLVYSAFGHAGQKCSAASLGIMVGSTYDSERYRRQLIDA
ASSMVVDWPSNLASTMGPLTEDPSDKLRRALTTLEPGESWLLEPKQLDDTGRLWSPGIKD
GVKPGSFFHLTEVFGPVLGLMHAKDLDEAIEFQNAVDFGLTGGIHSLDPEEVATWLDRVE
VGNAYVNRGITGAIVRRQSFGGWKQSSVGLGSKAGGPNYLMLFGHFADAGNQDLEAAKAD
DKRWFEAEFGAAKDHTGLRAEANIFRYRPRPVTLRVTAEASLFDLERSLHAARTVDSPVQ
LSVAEDVPAEVKIAVTNAGVPARTETAAEFAEMVGQGRYDDTVGARIRVLGRFEDELLAA
AAPRPEVAIIDEPVTTSGRVELRYYVQEQAVSMTLHRFGNPSRDFHELAASLTS
NT seq 3405 nt NT seq  +upstreamnt  +downstreamnt
ctgcacaccgaaaccgacctcgccacgctcactgcccagtcgatcgacaccgtccgccgg
tggctgcgagtgtcgacgtcgatgaccacggcgaagaaccccgcggccgaacgcctctcc
gccgtcctctccgacgacaacggcctcgacttcaccgtcgggttcgtcgatcgggtcgtg
cgcaccgatgatgtccacgccgccgccgacgccttgaccgaggtcggcaagctggccccc
gagacgatgtcgtacctcgaccgtgcacagatcaaggccggtgccgcactggccaagatc
gccccgcaggtcgtcgtccccgccgcccgcactcgcctgcgtcagatggtcggccacatg
gtcgtcgacgcccgggacaagcagttcggcaagaccgtcgccgccctcaccgccgacagt
caccggctcaacatcaacctcctcggcgaggccgtgctcggtgacggcgaagccgacaac
cacctggagcagacccaccggctgctcgcccgcgacgatgtcgactacgtgtcggtgaag
gtctcctccgtggcctcgcagatctcgatgtgggccttcgacgagaccgtcgactatgtc
gtcgaccgcctccgtccgctctaccagcaggccgcgaaagccccgaccggcgcgaagttc
gtcaacctcgacatggaggagtaccaggacctcgagctgacgatcgcagtgttcacgcgg
ctgctctccgaaccggagttcaaggatctcgaagccggaatcgtcatccaggcctaccag
cccgatgcgctcggcgcggtgcagcggctgagcgaattcgcctcccgccgtgtcgagaac
ggcggagtcgggatcaaggtccgcctcgtcaagggcgcgaacctcgcgatggagaccgtg
cacgccgaaatcgccggctggcctgcaacgacgtgcgattcgaagcagtccacggatgcg
aactacaagagggtcctgcattggctgttcaccccagagcggatgaaggggctgcgcatc
ggcgtggccgggcacaacctcttcgacatcgccttcgcccaccacctctccgtcgaacgc
tccgtgaccgaccgcgtcgaattcgagatgctccaaggcatggccagcgagcaggccgcc
gccgtgaccgaggacgtcggagacctcctcctctacgttcccgccgtgcacccgaaggaa
ttcgacgtcgcaatctcctacctcgtgcgcaggctcgaggagaactctgcgtccgagaac
ttcatgtccggcatcttcgacctcgcaaacggcaacgacgtgttcaagcgcgaagccgac
cggttcaccgcatccgtcaaccagctcgaatcgatcctcgagaccgagggcgaaaccgca
ccggccccgaaccgccaccagaaccggtcgaccgaaacactcggcgagaccgtggtgccg
acccagttcttcaatgaacccgacaccgacccggcccttccggccaaccaggaatgggtg
cgcaacatcatcgccgaggcgaccgcccccggatatctcgatgaccgtccgaatgcgccc
aaggtcggttccaccgacgagctcgatgagatgatcgcccgcggtcgcgccgcggctgcc
gactggcgggccctcggcgcggccggtcgcgccgaggtcctccaccgagccgcggacatc
ttcgcggcccgtcgcggcgagttcatcgcagtcgaggccgccgaggtcggcaagatgccg
tcgcagtccgaccccgaggtgtccgaggccatcgacttcatccgctactacgcgctgaac
tcgctcgaactcgacaacctcgacggagcggagttcaccccggacgagatggtcgtcatc
actcccccgtggaacttccccgtggccattcccaccggcggcaccgttgcgacgctggcg
gccggatccgcagtcatccacaagccttcgaaaccgactccgcactgttcggcgctcatc
atcgactgcctgtggcaggccggagtgcccaaggacgtgctgcagctgtgcgcaccgatc
gaacgggagctcggccagcacctcgtctcgcaccccgatgtcgaccgcgtcatcctcacg
ggggcttcggagaccgcagcgatgttcaaatccttccgtcccgaactccacgtcaatgcc
gagacctcgggcaagaacgccctggtcatcaccccggcggcggaccgagacctcgccatg
gccgacctcgtgtactccgccttcggacatgccggacagaagtgctcggccgcctcgttg
gggatcatggtcggatcgacctacgattccgagcgctaccgtcgccagctcatcgatgcc
gcctcgtcgatggtcgtcgattggccgtcgaacctcgcatcgaccatgggcccgctgacg
gaggacccctcggacaagctgcgtcgcgcactgacgactcttgagcccggcgaatcctgg
ctgctcgagcccaagcagctcgatgacaccggtcgcctgtggagcccgggaatcaaggac
ggggtcaagcccggttcgttcttccacctcaccgaggtcttcggtccggtgctcggtctc
atgcatgcgaaggacctcgatgaggccatcgagttccagaatgccgtggacttcggtctc
accggcggcatccattccctcgaccccgaggaggtcgccacctggctcgaccgcgtcgag
gtcggcaacgcctacgtcaaccgcggaatcaccggcgcgattgtgcgccggcagtccttc
ggcggctggaagcagtcctcagtcggactgggatcgaaggccggcggcccgaactacctc
atgctcttcggccacttcgccgatgccggcaaccaggatctcgaggcggccaaggccgat
gacaagcgctggttcgaggccgaattcggtgcggcgaaggaccacacgggactgcgcgcg
gaggcgaacatcttccgctaccgaccccgcccggtgaccctgcgcgtcaccgccgaggcg
agcctgttcgacctcgaacgctccctgcacgcagcccgcacggtggactcgccggtgcag
ctgtccgtggccgaggatgtgcccgcagaagtgaagatcgccgtgacgaatgccggtgtt
cccgcccgcaccgagactgccgccgagttcgccgagatggtcggccagggtcgctacgac
gacaccgtgggggctcgcatccgcgtgctcggtcggttcgaggacgagctgctggccgca
gccgcgcctcgcccggaggtcgcgatcatcgatgagccggtgaccacatcgggacgtgtg
gagctgcgctactacgtgcaggagcaggcggtgtcgatgaccttgcaccgcttcggcaac
ccgagccgcgacttccacgagctcgccgcctccctcacctcctaa

DBGET integrated database retrieval system