KEGG   Brucella abortus S19: BAbS19_II00590
Entry
BAbS19_II00590    CDS       T00703                                 
Name
(GenBank) type IV secretion system protein VirB5
  KO
K03200  type IV secretion system protein VirB5
Organism
bmc  Brucella abortus S19
Pathway
bmc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BAbS19_II00590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmc02044]
    BAbS19_II00590
Secretion system [BR:bmc02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BAbS19_II00590
SSDB
Motif
Pfam: T4SS DUF4141 Adhes-Ig_like DUF6376 RPW8 Kinesin_assoc UPF0242
Other DBs
NCBI-ProteinID: ACD73586
UniProt: A0A0F6ATF1
Position
2:complement(62030..62746)
AA seq 238 aa
MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKFAQQIEQLKQQFEQQKM
QFDALTGNRGLGDILRDPTLRSYLPHNWRDLYEAVMSGGYLAAAGETANLLRKSQVYDPC
ASISDKDQRIACEAKVVKPVQDKVMTSKAYDATDKRLQEIESLMQEINKTGDPKAIAELQ
GRIESENAMIQNEDTRLHLYQQMAEAQDKLLDERQHELDAKDNARRGYPQPKALEAAY
NT seq 717 nt   +upstreamnt  +downstreamnt
atgaagaagataattctcagcttcgcattcgccctgactgtaaccagcacggcgcacgca
cagctcccggtgacagatgccggctccatcgcgcagaacctggccaaccatctcgaacag
atggtgaagttcgcccagcagatcgagcaactgaaacagcagtttgaacaacagaaaatg
cagttcgatgccctgaccggcaaccgtggccttggcgatattctccgcgaccctacgctg
cgtagctatctgccacataactggcgagatctctacgaagcggtgatgagcggcggctac
ctggcggcggctggcgaaacggccaacctcttacgcaaaagccaggtatacgatccgtgt
gcctccatctccgacaaagatcagcgcatcgcatgtgaggctaaagtggtgaagccggtc
caggacaaggtcatgacgtccaaagcctacgacgccactgacaaacgcctacaagagatc
gagagcttgatgcaggagatcaacaagacgggagacccgaaggcgattgccgaattgcaa
ggccggatcgaaagcgaaaatgccatgatccaaaacgaagacacccgccttcatctctac
cagcagatggcagaggcacaggacaagctcctggacgaacgccagcacgaattagacgcg
aaggataatgcccggcgcggctatccgcagccgaaagcactggaagccgcctattaa

DBGET integrated database retrieval system