KEGG   Brucella microti: BMI_II67
Entry
BMI_II67          CDS       T00955                                 
Symbol
virB5
Name
(GenBank) type IV secretion system protein VirB5
  KO
K03200  type IV secretion system protein VirB5
Organism
bmr  Brucella microti
Pathway
bmr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMI_II67 (virB5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmr02044]
    BMI_II67 (virB5)
Secretion system [BR:bmr02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BMI_II67 (virB5)
SSDB
Motif
Pfam: T4SS Adhes-Ig_like DUF4141 RPW8 DUF6376 Kinesin_assoc UPF0242
Other DBs
NCBI-ProteinID: ACU49208
UniProt: C7LGS0
Position
2:complement(62230..62946)
AA seq 238 aa
MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKFAQQIEQLKQQFEQQKM
QFNALTGNRGLGDILRDPTLRSYLPYNWRDLYEAVMSGGYLAAAGETANLLRKSQVYDPC
ASISDKDQRIACEAKVVKPVQDKVMTSKAYDATDKRLQEIESLMQEINKTGDPKAIAELQ
GRIESENAMIQNEDTRLHLYQQMAKAQDKLLDERQHELDAKDNARRGYPQPKALEAAY
NT seq 717 nt   +upstreamnt  +downstreamnt
atgaagaagataattctcagcttcgcattcgccctgactgtaaccagcacggcgcacgca
cagctcccggtgacagatgccggctccatcgcgcagaacctggccaaccatctcgaacag
atggtgaagttcgcccagcagatcgagcaactgaaacagcagtttgaacaacagaaaatg
cagttcaatgccctgaccggcaaccgtggccttggcgatattctccgcgaccctacgctg
cgtagctatctgccatataactggcgagatctctatgaagcggtgatgagcggcggctac
ctggcggcggctggcgaaacggccaacctcttacgcaaaagccaggtatacgatccgtgt
gcctccatctccgacaaagatcagcgcatcgcatgtgaggctaaagtggtgaagccggtc
caggacaaggtcatgacgtccaaagcctacgacgccactgacaaacgcctacaagagatc
gagagcttgatgcaggagatcaacaagacgggagacccgaaggcgattgccgaattgcaa
ggccggatcgaaagcgaaaatgccatgatccaaaacgaagacacccgccttcatctctac
cagcagatggcaaaggcacaggacaagctcctggacgaacgccagcacgaattagacgcg
aaggataatgcccggcgcggctatccgcagccgaaagcactggaagccgcctattaa

DBGET integrated database retrieval system