KEGG   Brucella suis ATCC 23445: BSUIS_B0069
Entry
BSUIS_B0069       CDS       T00638                                 
Name
(GenBank) P-type DNA transfer protein VirB5
  KO
K03200  type IV secretion system protein VirB5
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSUIS_B0069
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmt02044]
    BSUIS_B0069
Secretion system [BR:bmt02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BSUIS_B0069
SSDB
Motif
Pfam: T4SS DUF4141 Adhes-Ig_like DUF6376 Kinesin_assoc RPW8 UPF0242 Phage_GPO
Other DBs
NCBI-ProteinID: ABY39096
UniProt: A9WX93
Position
II:complement(62241..62957)
AA seq 238 aa
MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKFAQQIEQLKQQFEEQKM
QFDALTGNRGLGDILRNPTLRSYLPHNWRDLYEAVMSGGYLAAAGETANLLRKSQVYDPC
ASISDKDQRIACEAKVVKPVQDKVMTSKAYDATDKRLQEIESLMQEINKTGDPKAIAELQ
GRIESENAMIQNEDTRLHLYQQMAEAQDKLLDERQHELDAKDNARRGYPQPKALEAAY
NT seq 717 nt   +upstreamnt  +downstreamnt
atgaagaagataattctcagcttcgcattcgccctgactgtaaccagcacggcgcacgca
cagctcccggtgacagatgccggctccatcgcgcagaacctggccaaccatctcgaacag
atggtgaagttcgcccagcagatcgagcaactgaaacagcagtttgaagaacagaaaatg
cagttcgatgccctgaccggtaaccgtggccttggcgatattctccgcaaccctacgctg
cgtagctatctgccacataactggcgagatctctacgaagcggtgatgagcggcggctac
ctggcggcggctggcgaaacggccaacctcttacgcaaaagccaggtatacgatccgtgt
gcctccatctccgacaaagatcagcgcatcgcatgtgaggctaaagtggtgaagccggtc
caggacaaggtcatgacgtccaaagcctacgacgccactgacaaacgcctacaagagatc
gagagcttgatgcaggagatcaacaagacgggagacccgaaggcgattgccgaattgcaa
ggccggatcgaaagcgaaaatgccatgatccaaaacgaagacacccgccttcatctctac
cagcagatggcagaggcacaggacaagctcctggacgaacgccagcacgaattagacgcg
aaggataatgcccggcgcggctatccgcagccgaaagcactggaagccgcctattaa

DBGET integrated database retrieval system