KEGG   Blautia producta: PMF13cell1_04739
Entry
PMF13cell1_04739  CDS       T05894                                 

Gene name
xdhA_4
Definition
(GenBank) Xanthine dehydrogenase molybdenum-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
bpro  Blautia producta
Pathway
bpro00230  Purine metabolism
bpro01100  Metabolic pathways
bpro01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PMF13cell1_04739 (xdhA_4)
Enzymes [BR:bpro01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     PMF13cell1_04739 (xdhA_4)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C Fimbrial_PilY2
Other DBs
NCBI-ProteinID: QBE99166
UniProt: A0A4P6M3U1
Position
complement(5309458..5311860)
AA seq 800 aa
MGVGSSINRVDAWEKVTGQAKYTADLMPQNLYTAKVVHSTIANGWVKSFDLEEALKVPGV
VKIVTCFDVPDIQFPTPGHPWSVEKAHQDIKDRKLLNRRVRMYGDDIAAVIAEDDIAAKR
AADKIKVEYEEYPVILDPQESMKEGAPLLHQEKPGNVIAHTGFVLGEGSFEEAVKEEGLT
VIEKEYRTQPVQHCHIEVPVSYAYMEKGRIVIVTSTQIPHIVRRVVSQALGIPIGQIRVI
KPYIGGGFGNKQDVLYEPLNAFLCTQAGGRGVRLELSREETLGCTRVRHAFTWKIKGAVR
KDGTLVARKYEAYSNQGAYASHAHAIAANAANIFKQLYQDEKVLESDSYTVYTNLMTGGA
MRGYGIPQGDFVTECVTDDLACAVGMDPLEFRLKNCVKEGYKDPHLGIAFHSYGLKACIE
KGREHIRWEEKRKAYENQSGPVRRGVGMAIFNYKTGVYPISLETSSCRMVLNQDGSMQLF
MGATEIGQGADTVFTQMAAEITGITEDRVHIETVQDTDTTPFDTGAYASRQTYVSGKAVK
KTGELFKQKILEYAAFKLKLSEEEITSNKVADPEALEACGQTSAWKRLDIKENQIIDKAS
GEVWLSLAALAEEALYSLEKSVHITAETTSHCKENSFASGACFVEVEVDIPVGKIRILDI
INVHDSGKLMNPALARAQVHGGMSMGIGYALSEELLVDEKTGRPLNANLLDYKIPTAMDT
PDLHTDFVELEDPTGPFGNKALGEPPAIPVAPAIRNAVLNATGVAFDSLPLSPQKLVERF
IKEGLIGRKNEDLEGGGSHV
NT seq 2403 nt   +upstreamnt  +downstreamnt
atgggagttggcagttcaataaatcgtgtggacgcctgggaaaaggtcacaggacaggcg
aagtacacagcggatttaatgccgcagaatttgtatacagcaaaagtggtgcacagcacc
attgcgaacggatgggtgaaaagctttgatctggaggaagccttaaaggttccgggagtg
gtgaagatcgtcacctgcttcgatgtgccggatatccagtttcccacgccggggcacccc
tggtcagtggaaaaggcacatcaggatattaaggacagaaagcttttgaaccggcgggtc
cgcatgtacggggatgatatcgccgctgtgatcgcggaggatgatattgccgccaagcgg
gctgcggataagatcaaagtggagtatgaagagtacccggtgatcctggatcctcaggag
tccatgaaagaaggtgcgcctcttttgcaccaggaaaaaccgggaaatgtaatcgcgcat
accggctttgtgctgggagagggaagttttgaggaggctgtaaaagaagaagggctgact
gtcattgagaaggaatacaggacacagccggttcagcactgccatattgaggtgcctgtc
tcctatgcttatatggagaaggggaggatcgtcattgtgacatccacccagattcctcat
attgtgaggcgggtggtcagtcaggctcttgggattcccattgggcagatcagggttatc
aagccatatataggaggaggcttcggcaacaagcaggatgtgctgtatgagcctttgaac
gcatttttatgtacccaggcaggcggccgcggtgtcagactggagctgtccagagaggag
actcttggctgtacccgtgtacgccatgcgtttacctggaagatcaagggggcagtcaga
aaagacggcacactggtggcgagaaagtatgaggcatactctaaccagggcgcttacgcc
tcccatgctcacgccattgccgccaatgcagccaacattttcaagcagctttatcaggat
gagaaggttctggaatctgacagctacacggtttacaccaatctcatgacaggcggagcc
atgcggggatacggaattcctcagggagattttgtgacagagtgtgtgacggatgatctg
gcctgcgctgtgggcatggatcctctggaattccggctgaaaaactgtgtgaaggagggt
tataaagaccctcatctgggcatcgctttccattcctacgggctgaaagcctgtatagaa
aagggcagggaacacatccgctgggaggaaaagagaaaggcatatgagaaccagtccggg
cctgtgagaaggggcgtcggcatggccatattcaactataaaacaggagtttaccccatt
tccctagagacctcatcctgccgaatggttttgaaccaggacggctccatgcagctcttt
atgggggcaacagagataggtcagggagctgacacggtgtttacccagatggcggcagag
ataaccggcataactgaggacagggtacatattgagaccgtacaggatacggataccaca
ccttttgatacaggagcctacgcgtcccggcagacctatgtgagcggaaaagccgtcaag
aagacaggggaactgttcaaacagaaaattctagaatatgcggcatttaagctgaagctg
tcagaggaagagataacatcaaacaaagtggcagatcctgaagctctggaagcatgtggg
cagacttctgcatggaagagactggatatcaaagaaaaccagataatagacaaagcctcc
ggggaggtttggctctcacttgcggccctggcggaggaggcactgtacagtttggagaaa
tcggtgcatatcacggctgagactaccagccactgcaaggaaaattcctttgcctcaggt
gcctgttttgtggaggttgaggtggatataccggttggtaagatcaggatactggatatc
atcaatgtacacgacagcgggaaactgatgaatccggcccttgccagagcgcaggtacac
gggggaatgagtatggggatcggctatgctctgagtgaggagctgctggtggatgagaag
acaggaaggccgctgaatgccaaccttctggactataagatacccacagctatggataca
cctgatctgcatacagattttgtggaacttgaggatcctaccggtcctttcgggaacaaa
gccctcggagagccgccggccattcctgtggccccggctatcagaaacgctgtgctcaac
gccaccggggtcgcttttgattccctgcctctgtcacctcagaagcttgtggagcgcttt
ataaaagagggattgatcggaagaaaaaatgaggatttggaagggggcggatcacatgta
tga

DBGET integrated database retrieval system