KEGG   Burkholderia pseudomallei K96243: BPSL2503
Entry
BPSL2503          CDS       T00203                                 

Definition
(GenBank) ABC transporter, ATP-binding component
  KO
K02071  D-methionine transport system ATP-binding protein
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BPSL2503
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bps02000]
    BPSL2503
Transporters [BR:bps02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   D-Methionine transporter
    BPSL2503
SSDB
Motif
Pfam: ABC_tran NIL AAA_21 SMC_N TniB AAA_29 ABC_ATPase AAA_22 AAA_16 MMR_HSR1 AAA_30 RsgA_GTPase AAA_23 DUF87 SbcCD_C
Other DBs
NCBI-ProteinID: CAH36509
UniProt: Q63S19
Position
1:complement(3016015..3017049)
AA seq 344 aa
MIEIRNLSQRFEGPRGWIEALHNVNLTIPQGEVFGIIGRSGAGKSTLVRTINLLTRPSEG
SVFVGGRDLTQLSAAELRGARRDIGMIFQHFNLLSSRTVFDNVALPLELAGVKRAQIEAT
VLPLLDLVGLAAQKDRYPAQISGGQKQRVGIARALASKPKVLLSDEATSALDPETTRAIL
DLLRRINRELGLTIVLITHQMEVIKDVCDRVAVLDAGRVVEEGNVIDVFMRPHHEVTRAL
IGDVIAQELPPAMKARVAERLKTGSGHLLRLAFTGSGVDQPILSETIRRYELDFNILHGQ
IDEIQGRAFGSLAVLATGEPGKVGQAFAYLREQGVVVEELSYVE
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgatcgaaattcgcaacctttcgcagcgtttcgaggggcctcgcggctggatcgaagcg
ctgcacaacgtcaatctgacgattccgcagggcgaggtattcggcatcatcggccgcagc
ggcgcgggcaagagcacgctcgtgcgcacgatcaacctgctcacgcggccgtccgagggc
agcgtgttcgtcggcgggcgcgacctgacgcaattgtcggcggccgaactgcgcggcgcg
cggcgcgatatcgggatgatcttccagcacttcaatctgctgtcgtcgcgcaccgtgttc
gacaacgtcgcgctgccgctcgagctcgccggcgtgaagcgcgcgcaaatcgaggcgacc
gtgctgccgctactcgatctggtcggcctcgccgcgcagaaggaccgctatccggcgcag
atcagcggcgggcagaagcagcgcgtcggcatcgcgcgcgcgctcgcgagcaagccgaag
gtgctgctgtccgacgaagcgacgtccgcgctcgaccccgagacgacccgcgcgattctc
gatctgctgcgccgcatcaaccgcgagctcggtctcacgatcgtcctcatcacgcaccag
atggaagtgatcaaggacgtgtgcgatcgcgtcgcggtgctggatgcggggcgcgtcgtc
gaggaaggcaacgtgatcgacgtgttcatgcgcccgcatcacgaagtcacgcgcgcgctg
atcggcgacgtgatcgcgcaggaactgccgcccgcgatgaaggcgcgcgtcgccgagcgc
ctgaagacgggctcgggccatctgctgcgcctcgcgttcacgggctcgggcgtcgatcag
ccgatcctgtcggagacgatccggcgctacgagctggacttcaacatcctgcacggccag
atcgacgagatccaggggcgcgcattcggttcgctcgcggtgctcgccacgggcgagccg
ggcaaggtggggcaggcgttcgcgtatctgcgcgagcagggcgtggtcgtcgaggagctt
tcgtatgttgagtga

DBGET integrated database retrieval system