KEGG   Burkholderia pseudomallei K96243: BPSS0180
Entry
BPSS0180          CDS       T00203                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS0180
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS0180
SSDB
Motif
Pfam: ImpA_N SelP_N
Other DBs
NCBI-ProteinID: CAH37625
UniProt: Q63NW8
Position
2:240310..241455
AA seq 381 aa
MTPSRKPAGRAAAARTPKPDGWMAPVDAAAPCGADLEYDPEFVVLAAKVAPRAEAQYGDF
VGSPEPVNWSDVERDCRRLMMRSKDMRLAVLFARSRTRLAGATGLAEGIGLLAAWLAAFP
DAIHPQADVDADRDAALEIRRNALQALTDADGLLADVREIALTRSSATRLQVRDVERAFA
QPRPGDALAPESVVRQLDDLHAQQPETLAGFGDALAGLAAIDAWSGEHLGDYAPDLSALD
ALLRRIAGANARGDRAEAEPIAPAEADAPPASEAAAAHAHAHAHAHAHAHAHAHASPPRR
REPAAQALAAAIAGEPAAQPVDRYAARELIRQARQWFEQHEPSSPIPILLRRAEHFVGKR
YADVVQAIPAELLALWSADET
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgacccccagcagaaaaccggccggcagggcggctgccgcgcgtacgccgaagcccgac
ggctggatggcgcccgtcgatgcggccgcgccgtgcggagcggaccttgaatacgatccc
gagttcgtcgtgctcgcggcgaaggtcgcgccgcgcgccgaagcgcagtacggggacttc
gtcggctcgccggagccggtgaactggagcgacgtcgagcgcgactgccgacggctgatg
atgcgcagcaaggacatgcgcctcgcggtgctgttcgcgcgcagccgcacgcggcttgcc
ggcgcgaccgggctcgcggaaggcattggcttgctggccgcgtggctcgccgcgtttccc
gatgcgattcatccgcaagccgacgtcgacgcggaccgcgacgcggcgctcgagatccgg
cgcaacgcgctgcaggcgctgaccgatgccgacgggctgctggcggacgtgcgcgagatc
gcgctgacccgctcgagcgcgacgcgcctgcaggtgcgcgacgtggaacgcgcgttcgcg
caaccgcggcccggcgatgcgctcgcgccggaatcggtcgtgcgccagctcgacgatttg
cacgcgcagcagccggagacgctcgcgggcttcggcgatgcgctcgcggggctggccgcg
atcgacgcctggagcggcgagcatctcggcgattatgcgccggacctgtcggcgctcgat
gcgctgctgcgccggatcgcgggcgcgaacgcgcgcggcgatcgcgcggaggccgagccg
atcgcgccggccgaagccgatgcgccgccagcgagcgaggcggcggccgcgcacgcgcac
gcgcacgcgcacgcacacgcacacgcacacgcgcacgcacacgcatcgccgccgcggcgg
cgcgagcccgcggcgcaggcactcgcggctgccattgcgggcgaaccggccgcgcagccg
gtggatcgttacgcggcgcgcgagctgatccggcaggcgcgccagtggttcgagcagcac
gagccgagcagcccgattccgattctgctcaggcgcgcggagcatttcgtcggcaagcgc
tatgcggatgtggtgcaggcgattcccgccgagctgctcgcgctgtggagcgcggacgaa
acctga

DBGET integrated database retrieval system