KEGG   Burkholderia pseudomallei K96243: BPSS0522
Entry
BPSS0522          CDS       T00203                                 

Definition
(GenBank) putative ATPase
  KO
K11907  type VI secretion system protein VasG
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BPSS0522
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS0522
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS0522
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 AAA_16 ClpB_D2-small AAA_22 Sigma54_activat Clp_N TniB NACHT AAA_7 Zeta_toxin SRP54 Torsin AAA_18 AAA_24 DUF815 Mg_chelatase RsgA_GTPase
Other DBs
NCBI-ProteinID: CAH37979
UniProt: Q63MX6
Position
2:709191..712061
AA seq 956 aa
MNRERIFNCLGRTTYAALVDATALGRSRRHAFIDLDHWALCLLQREQSDLARLFELFGSD
AGEAKRRMEKALDGFDVSGDSLRDISSSLERSVGPAVIWSQIAARAGKVRSGHLLLAWLD
EDLTRRWLQQRVPSGITSVALDDVVKRYEALAAGWPEADEAPAALDGAALGAQAGEAGAD
GTGDALAKWATCVTEQAARGELDPVVGRDDELRTVIDILSRRRQNNPILVGEAGVGKTAV
VEALAQKIHAGAVPPGLVGAQVWALDLARMQAGAGVRGEFEQRLKSLIDAVIASPAPIIL
FCDETHTLIGAGGAAGTGDAANLIKPMLARGQLRMVAATTWSEYKQYIEPDAALVRRFQA
VAVDEPSDDAAVDMLRTIAPRFAAHHGVRIVDSALRGAVELSRRYLPARQLPDKAISLLD
TACARVAMSQSCAPAELERLQHQAFAIGQTLDWRASDRRMGVRTPGDEAELEGRQASLAQ
QAATLETVVDAQRDEVRAWLARLNDATPQAADGDGAAFAARIGANRWVRPWVDEHVVSEV
LAEWTGVPVAQLAQDDAQRVVELEAALNAGIHGQTGAMRSIAQALQVSHSGLNDPRRPLG
VMLLAGPTGTGKSQAAAKLAELLFGGERNLLQFNMNEFQEAHTVSTLKGAPPGYVGYGKG
GRLTEAVRKKPYSVLLLDEFDRAHPDIHEVFYQVFDQGWMEDGEGRRISFRNCLILLTSN
LGEAEIEAACKADPRISQAKLDKLVGERLQGRFSPALLARIQLVAFRTLDVDALTGIATQ
ALDELGERLAQNDLQWRADEGVASWIAHAVSQHPANGRAVRDLLRQHVMPAVARGVLAAR
AEGRALKTVRLAANEKLSLVFDEDAWELSGTDAASLGEQAQAVAMAREAEAVAAAVAARE
AHGAHGTNEADGGGGAPHAAKADAHVDSDDERPGGAPHPDETASANAGTTGEPSCV
NT seq 2871 nt   +upstreamnt  +downstreamnt
gtgaatcgcgaacgcatattcaactgtctcggccgcacgacctatgcggcccttgtcgat
gcgacggcgctgggccgatcgcgtcggcacgccttcatcgatctcgatcactgggcgctg
tgcctgctgcagcgcgagcagagcgatctcgcgcggctgttcgaactgttcggcagcgat
gccggcgaagcgaagcgccgcatggagaaggcgctcgacggcttcgacgtgagcggcgac
tcgctgcgcgacatctccagctcgctggagcgcagcgtggggccggccgtcatctggagc
cagatcgcggcgcgcgcgggcaaggtgcgctccggccacctgctgctcgcgtggctcgac
gaggatctgacgcgccgctggctgcagcagcgcgtgccgagcggcatcacgtcggtggcg
ctcgacgacgtggtgaagcgctatgaggcgctcgcggcgggctggccggaggccgacgag
gcgccggccgcgctggacggcgcggcgctgggcgcgcaggcgggcgaagccggcgcagac
ggcacgggcgacgcgctcgcgaagtgggcgacgtgcgtgacggagcaggccgcgcgcggc
gagctcgatccggtggtggggcgcgacgacgaattgcgcacggtgatcgacattctgtcg
cgccgccggcagaacaacccgatcctcgtgggcgaggcgggggtgggcaagacggccgtg
gtcgaggcgctcgcgcagaagatccacgcgggcgcggtgccgccggggctcgtgggcgcg
caggtgtgggcgctcgacctggcgcggatgcaggcgggcgcgggggtgcgcggcgagttc
gagcagcgcctgaaatcgctgatcgacgcggtgatcgcctcgcccgcgccgatcatcctg
ttctgcgacgagacgcacacgctgatcggcgcgggcggcgcggcgggcacgggcgacgcg
gccaacctgatcaagccgatgctcgcgcgcggccaattgaggatggtcgcggcgacgacg
tggtccgaatacaagcagtacatcgagccggacgcggcgctcgtgcggcgcttccaggcg
gtcgcggtcgacgaaccgagcgacgatgcggcggtcgacatgctgcgcacgatcgcgccg
cgctttgccgcgcaccacggcgtgcgcatcgtcgattcggcgctgcgcggcgcggtcgag
ctgtcgcgccgctatctgcccgcgcggcagttgccggacaaggcgatcagcctgctcgac
accgcgtgcgcgcgcgtggcgatgagccagagctgcgcgcccgcggagctcgagcgcttg
cagcaccaggcgttcgcgatcggccagacgctcgattggcgcgcgagcgaccggcgcatg
ggcgtgcgcacgccgggcgacgaagccgagctcgaaggccgtcaggcgagcctcgcgcag
caggcggcgacgctcgagacggtcgtggacgcgcagcgcgacgaggtgcgtgcgtggctc
gcgcggctgaacgacgccacgccgcaggcggccgacggcgacggcgctgcgttcgccgcg
cgcatcggcgcgaatcgctgggtgcggccatgggtcgacgaacacgtggtgtcggaggtg
ctcgccgaatggacgggggtgcccgtcgcgcagctcgcgcaggacgacgcgcagcgcgtg
gtggagctcgaggcggcattgaacgcgggcatccacgggcagacgggcgcgatgcgctcg
atcgcgcaggcgctgcaggtgtcgcactcggggctgaacgatccgcgccgcccgctcggc
gtgatgctgctcgcggggccgacgggcacgggcaagagccaggcggccgcgaagctcgcc
gagctgctgttcggcggcgagcgcaacctgctgcagttcaacatgaacgagttccaggaa
gcgcacacggtgtcgacgctcaagggcgcgccgccggggtacgtcggctacggcaagggc
ggtcggctgaccgaggcggtgcgcaagaagccgtacagcgtgctgctgctggacgaattc
gatcgcgcgcatccggacattcatgaggtgttctatcaagtcttcgatcaggggtggatg
gaggacggcgaaggtcgccggatcagcttccgcaactgcctgatcctgctgacgagcaat
ctgggggaggcggagatcgaagcggcgtgcaaggccgatccgcggatctcgcaggcgaag
ctcgacaagctggtgggcgagcggctgcaggggcgtttctcgccggcgctgctcgcgcgg
attcagctcgtggcgttccgcacgctcgatgtcgacgcgttgacgggcatcgcgacgcag
gcgctggacgagctgggcgagcgcctggcgcagaacgatctgcaatggcgcgcggacgaa
ggcgtggcgtcgtggatcgcgcatgcggtgtcgcagcatccggcgaacggacgcgcggtg
cgcgacctgttgcgccagcacgtgatgccggccgtggcgcgcggcgtgctcgccgcgcgt
gcggaagggcgagcgctgaagacggtgcggctcgcggcgaacgagaagctgtcgctcgtg
ttcgacgaggacgcgtgggagctgagcggcaccgatgcggcgtcgctcggcgagcaggcg
caggcggtggcgatggcgcgcgaggcggaggcggtggccgctgccgtggcggcacgcgaa
gcgcacggcgcgcacggcacgaatgaggcggatggaggcggcggcgcgccgcacgcggcg
aaagccgacgcgcatgtcgattcggatgacgaacgtccaggcggcgcgcctcatcccgat
gaaacggcttcggcgaacgccggcacgacgggagaaccgtcatgcgtctga

DBGET integrated database retrieval system