KEGG   Paraburkholderia phytofirmans: Bphyt_4919Help
Entry
Bphyt_4919        CDS       T00765                                 

Definition
(GenBank) type VI secretion ATPase, ClpV1 family
  KO
K11907  type VI secretion system protein VasG
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bphyt_4919
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpy02044]
    Bphyt_4919
Secretion system [BR:bpy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bphyt_4919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small Clp_N AAA_16 Sigma54_activat AAA_7 TniB AAA_30 NACHT AAA_29 ResIII SRP54 AAA_33 Zeta_toxin TMCO5 AAA_23
Motif
Other DBs
NCBI-ProteinID: ACD19283
UniProt: B2TC63
Position
2:1044410..1047085
Genome map
AA seq 891 aa AA seqDB search
MSTSLNTLIAKLNPTCRQAALLAANNCLARGHYEVDLEHLLLPLLDEPASDVALVLRASR
IDPHALRADLERELQRLKTGNTRTPVFSKHLIELLEQAWLIASLDSQIGRIRSGHLLLAL
LSAPDLAQFAERMSPLLRDVRVTDLKHKFDELTAGSREVEHSNDTQSAGDSASDPVASAV
APGAPSKTPALDTYTSNLTQRAREGKIDPVIGREGEIRQAIDILMRRRQNNPIMTGEAGV
GKTAVVEGLALRIAADDVPAPLKGVALHVLDMGLLQAGASVKGEFENRLKNVIDEVKKSP
HPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKKYFEKDAALA
RRFQVVKIEEPSEALAAAMLRGMASLMEKHFNVRVLDDAITEAVRLSHRYISGRQLPDKA
ISVLDTACAKVALAHSSTPATIDDTKKRLERIDAEIAALEREAASGALHDERLAELRGLR
EEDLKDLAADEARYDKERVLVTEIVGLRADIDAARVNSAGPEQADKAQQAREKLAARVAE
LHALQGGQPMVPLQVDAHVVAEIVASWTGIPLGRMVKDEIQTVLNLQPLLAARVIGQDHA
LEAIAQRVRTASANLEDPNKPRGVFMFVGPSGVGKTETALALADVLYGGERKMVTINMSE
YQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDEVEKAHPEVLEMFFQVFDK
GTMDDAEGREIDFRNTLIILTSNVGSQAVMQACLNKSAEELPDADELAETLRLQLYKAFK
PAFLGRMKVVPYYPISDDVLAEIIELKLDRIRRRIESNHKAVFEWDESLVDAVLARCTEV
DSGARNVDHILNGTLLPEVAQQVLERVANGAAIERIAVRASEAGEFDYTVV
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgtccctcaataccctgatcgccaaactgaatccgacctgccggcaggcggct
ttgctggcggcgaacaattgtctcgcgcgcggtcactacgaggtcgacctcgagcatctg
ctgctcccgctgctggacgaaccggccagcgacgtcgcactggtgctgcgcgcgagcagg
atcgacccgcacgccttgcgcgcggatctcgagcgcgagttgcagcgtttgaaaaccggc
aatacgcgtacgccggtgttttcgaagcatctgatcgagttgctcgaacaggcgtggttg
attgcatcgcttgattcgcagattgggcggattcgctcagggcatctgctactggcgctt
ttgagcgcaccggatctcgcgcaattcgccgagcgcatgtcgccgctgctgcgcgacgtg
cgtgtgaccgacctgaagcacaaattcgatgagctgactgcgggttcgcgcgaagtcgag
cacagcaatgacacgcaaagcgcgggagatagcgcgagtgatccggtggcgagcgctgtc
gcgccgggcgcgccgtctaaaacgcccgcgctcgatacctacaccagcaacctcacgcag
cgtgcgcgggaaggcaagatcgatccggtgatcggccgcgaaggcgagattcgccaggcc
atcgatattctgatgcggcgccgccagaacaatccgatcatgacgggcgaagcgggcgtc
ggtaaaacggccgtggtcgaaggtctcgcgctgcgcattgccgccgacgatgtgcccgcg
ccgctcaaaggcgtcgcgctgcacgtgctcgacatggggttgctgcaagccggcgcgagc
gtgaaaggcgagttcgaaaaccgcctgaagaatgtgatcgatgaggtcaagaagagtccg
catccaatcattctctttatcgacgaagcgcacaccatcatcggcgccggtggtcaggcc
gggcagaacgatgcggccaatctgctgaagccggccttggcgcgcggcgaattgcgcacc
atcgcggccaccacgtggagcgagtacaagaagtacttcgagaaagacgcggcgctcgcg
cggcgtttccaggtcgtgaagatcgaggagcctagcgaggcgctcgccgcggctatgttg
cgcggcatggcttcgctgatggaaaagcatttcaatgtgcgcgtgctggatgatgcgatc
acagaagccgtgcgtctgtcgcatcgctacatcagcggccggcaactgccggataaagcg
atcagcgtgctcgacaccgcttgcgcgaaagtcgcgctcgcgcacagttcgacaccggcg
accatcgacgacacgaaaaaacgcctcgaacgtatcgacgctgaaatcgccgcgctggaa
cgcgaagcggcgagcggcgcgctgcacgatgaacgcctcgctgaattgcgcggcctgcgt
gaagaggacctcaaagacctcgccgcagacgaagcgcgctacgacaaggaacgcgtattg
gtgacggagatagtcggcttgcgcgctgacatcgacgcggcgcgcgtgaacagcgcgggc
ccggagcaggcggataaggcacagcaggcgcgcgaaaagcttgccgcgcgcgtcgccgaa
ttgcacgccttgcaaggcggccaaccgatggtgccgctgcaggtcgacgctcatgtggtc
gccgaaatcgtcgcctcgtggaccggcattccgctcggccgcatggtcaaggacgaaatc
cagaccgtgctgaacctgcagccgttgctggccgcgcgtgtgatcggtcaggaccatgcg
ctcgaagcgatcgcgcagcgcgtgcgcaccgctagtgcgaatcttgaagacccgaacaag
ccgcgcggcgtgttcatgttcgtcggaccgtcgggcgtcggcaagaccgaaaccgcgctt
gcgctggccgatgtgctgtacggcggcgaacgcaagatggtcacgatcaacatgagcgag
tatcaggaagcgcacagcgtgtccggcctgaagggttccccgccgggctatgtcggttac
ggcgagggcggtgtgctgaccgaagcggtgcgccgcaatccgtattcggtggtgctgctc
gacgaagtcgaaaaggcgcaccccgaagtgctcgaaatgttcttccaggtgttcgacaaa
ggcacgatggacgacgccgaaggccgcgagatcgatttccgcaacacgttgatcattctg
acttcgaatgtcggctcgcaggcggtgatgcaggcgtgcctgaacaagagcgcggaagaa
ctgcccgacgccgatgaactcgcggaaaccttgcgtctgcagttatacaaagcattcaaa
ccggcatttctcggccgcatgaaagtggtgccgtactatccgatttccgacgacgtactg
gccgagatcatcgaattgaaactcgaccggattcgccgccgcatcgagtcgaatcacaag
gcagtgttcgagtgggacgagtcgctggtcgatgcggtgctcgcgcgttgcaccgaggtg
gattccggcgcacgcaatgtggatcacattctgaacggcacgctcctgcccgaagtcgcg
cagcaggtgctggaacgtgtggcgaacggcgccgcgatcgagcgcattgccgtgcgcgcg
agcgaggcgggtgagttcgactacacggtggtgtga

DBGET integrated database retrieval system