KEGG   Brassica rapa (field mustard): 103860984Help
Entry
103860984         CDS       T03449                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00906  Carotenoid biosynthesis
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
Module
brp_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    103860984
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     103860984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 103860984
NCBI-ProteinID: XP_009136923
Position
A3
AA seq 583 aa AA seqDB search
MVSLLTMSMSGAQTWPQAHTDLGFGPIKRQPKIKCTVHIDVTELPLKRPSFTPRTTATPP
RHNPLRLNIFQKAAAIAIDAAERVLISREQDTPLPKTADPRIQIAGNYFPVPEFPVRECL
DVEGTIPDCIDGVYVRNGANPMFEPIAGHHLFDGDGMVHAVKITNGSASYACRFTKTERL
IQEKRLGRPVFPKAIGELHGHSGIARLMLFYARGLCGLVNNQNGVGVANAGLVYFNNRLL
AMSEDDLPYQLKITQTGDLQTVGRYDFDGQLKSSMIAHPKLDPVTKELHALSYDVVKKPY
LKYFRFSPDGVKSPELEIPLETPTMIHDFAITENFVVIPDQQVVFKLGEMIAGNSPVVFD
GEKVSRLGIMPKDATEASEIIWVNSPETFCFHLWNAWESPETEEVVVIGSCMSPADSIFN
ERDESLRSVLTEIRINLRTREATRRALLEDDVNLEIGMVNRNRLGRKTRFAFLAIADPWP
KVSGFAKVDLFTGEIEKYIYGGEKYGGEPFFLPSGSFDGNGGENEDDGYIFSHVHDEEKE
TSELQIINAVNLKLEATIKLPSRVPYGFHGTFVDSSELVDQSL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggtttctctgcttacaatgtcgatgagtggtgctcaaacatggcctcaggcccatact
gatttaggctttgggcccatcaaaagacagccgaagattaaatgcacggtgcatatcgac
gtaacggaattacccttgaaacggccttcattcacacccagaaccaccgcgacgccaccg
cggcataatcctctccggctaaacattttccagaaagcggcggcgattgcgatcgatgcg
gctgagcgcgttttaatctcacgtgagcaagatactcctcttcccaaaaccgctgatcca
cgtattcaaatcgccgggaattattttccggtaccggagtttcccgtccgagagtgtctc
gacgttgaaggaacaatccctgactgcattgacggagtttatgtccgtaacggcgcaaat
ccgatgttcgagcctatcgctgggcatcatttattcgacggagacggaatggttcacgcc
gttaaaataactaacggttcagcaagctacgcatgccggtttactaaaaccgagagattg
attcaagaaaaacgattgggtcgaccggtttttccgaaagcaatcggcgagcttcacggc
cactcgggaatcgcacgtctgatgcttttttacgcacgtgggctttgcggtctcgtcaac
aatcaaaacggcgtcggagtagcaaatgccggtttggtttacttcaataaccggctttta
gcaatgtcagaagacgatttaccgtaccaactaaaaataactcaaaccggcgatctccaa
accgttgggcgttacgatttcgacggtcagttaaaatcatcgatgatcgcccacccgaaa
ctcgacccggttacaaaggagctccacgctctaagctacgacgtcgttaaaaagccttac
ctgaagtacttcagattctcgccggacggcgttaaatcaccggagctggagatcccgctc
gagactccgacgatgattcacgatttcgccataacggagaatttcgtggtgattccggat
cagcaagtcgtgtttaagctaggggagatgatcgccggaaactctccggtggttttcgac
ggcgaaaaggtttcgcgattggggataatgccgaaagacgcgacggaggcttccgagata
atctgggtgaattcgccggagacattctgtttccatctttggaacgcgtgggaatcgccg
gagacggaggaagtggtggtgatcgggtcgtgtatgtcgccggcggattctatcttcaac
gagagagacgagagcttgagaagcgtcttgacagagatcaggataaacctcaggacgcgt
gaagccacgcgacgcgcgttgctggaggacgatgtgaatttagaaatcggtatggttaac
cggaaccggttaggtagaaaaacccggttcgcgtttctggctatcgctgatccttggcca
aaagtttccggtttcgctaaggttgatcttttcaccggagaaatcgaaaagtacatttac
ggcggcgagaagtacggtggagaaccgtttttcttgcccagtggctcctttgacggtaac
ggaggagaaaatgaagatgacggctatatattctctcacgttcacgacgaagagaaagag
acgtccgaacttcagattattaacgccgttaatttaaagcttgaagctacgattaaacta
ccgtctagagtaccgtatgggtttcatggtacatttgtggattcaagtgaactcgtggat
caatcattataa

DBGET integrated database retrieval system