KEGG   Brucella suis 1330: BS1330_II0065
Entry
BS1330_II0065     CDS       T02103                                 
Name
(GenBank) type IV secretion system protein VirB5
  KO
K03200  type IV secretion system protein VirB5
Organism
bsi  Brucella suis 1330
Pathway
bsi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bsi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BS1330_II0065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsi02044]
    BS1330_II0065
Secretion system [BR:bsi02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BS1330_II0065
SSDB
Motif
Pfam: T4SS DUF4141 Adhes-Ig_like RPW8 Kinesin_assoc DUF6376 UPF0242
Other DBs
NCBI-ProteinID: AEM19557
UniProt: Q9RPY0
Position
II:complement(62192..62908)
AA seq 238 aa
MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKFAQQIEQLKQQFEEQKM
QFDALTGYRGLGDILRDPTLRSYLPHNWRDLYEAVMSGGYLAAAGETANLLRKSQVYDPC
ASISDKDQRIACEAKVVKPVQDKVMTSKAYDATDKRLQEIESLMQEINKTGDPKAIAELQ
GRIESENAMIQNEDTRLHLYQQMAEAQDKLLDERQHELDAKDNARRGYPQPKALEAAY
NT seq 717 nt   +upstreamnt  +downstreamnt
atgaagaagataattctcagcttcgcattcgccctgactgtaaccagcacggcgcacgcg
cagctcccggtgacagatgccggctccatcgcgcagaacctggccaaccatctcgaacag
atggtgaagttcgcccagcagatcgagcaactgaaacagcagtttgaagaacagaaaatg
cagttcgatgccctgaccggctaccgtggccttggcgatattctccgcgaccctacgctg
cgtagctatctgccacataactggcgagatctctacgaagcggtgatgagcggcggctac
ctggcggcggctggcgaaacggccaacctcttacgcaaaagccaggtatacgatccgtgt
gcctccatctccgacaaagatcagcgcatcgcatgtgaggctaaagtggtgaagccggtc
caggacaaggtcatgacgtccaaagcctacgacgccactgacaaacgcctacaagagatc
gagagcttgatgcaggagatcaacaagacgggagacccgaaggcgattgccgaattgcaa
ggccggatcgaaagcgaaaatgccatgatccaaaacgaagacacccgccttcatctctac
cagcagatggcagaggcacaggacaagctcctggacgaacgccagcacgaattagacgcg
aaggataatgcccggcgcggctatccgcagccgaaagcactggaagccgcctattaa

DBGET integrated database retrieval system