KEGG   Burkholderia stagnalis: WT74_13420Help
Entry
WT74_13420        CDS       T04885                                 

Definition
(GenBank) phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00770  Pantothenate and CoA biosynthesis
bstg01100  Metabolic pathways
Module
bstg_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    WT74_13420
Enzymes [BR:bstg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     WT74_13420
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     WT74_13420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein FMN_red SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: AOK53614
UniProt: A0A3P0IRW7
Position
1:3007279..3008490
Genome map
AA seq 403 aa AA seqDB search
MAHAELAGKHLVLGLTGGIACYKIAELTRLLTKAGATVQVAMTEAATQFITPVTMQALSG
RPVYTSQWDARIDNNMAHIDLSREADAIVIAPASTDFLAKLAHGFADDLLSTLCVARDCP
LLVVPAMNRQMWQNPATQRNVAQLRADGVSVLGPDSGAQACGEIGDGRMLEPEAIYEAIV
AHFQPKRLAHRRVLITAGPTFEPLDPVRGLTNRSSGKMGFALARAAQQAGAEVHLIAGPV
GLATPWGVYREDVQTAQQMYDAVMNAVPDADIFIAVAAVADWRAAQPAEHKMKKTADRKM
PELTFVENPDILATVAALPDPPFCVGFAAESGDLDVHGDEKRKRKNVPLLVGNLGPQTFG
RDDNEVALFDAAGITCLPRAPKDALAHVLVDEIAKRLPDNSLI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttggcacacgcagaactcgcaggaaaacatctcgtcctcggcctgacgggcggcatcgcc
tgctacaagatcgccgagctcacccgcctgctcaccaaggccggcgcgaccgtgcaggtc
gcgatgacggaagccgcgacccagttcatcacgcccgtcacgatgcaggcgctgtccggc
cggcccgtctacacgagccagtgggacgcgcgcatcgacaacaacatggcgcacatcgac
ctgtcgcgcgaagccgacgcgatcgtcatcgcgcccgcgtcgaccgacttcctcgcgaag
ctcgcgcacgggttcgcggacgacctgctgtcgacgctgtgcgtcgcccgcgattgcccg
ctgctcgtcgtgcccgcgatgaaccgccagatgtggcagaacccggccacgcagcgcaac
gtcgcgcagctgcgcgccgacggcgtgtcggtgctcggccccgactccggcgcgcaggcg
tgcggcgagatcggcgacggccgcatgctcgagccggaagcgatctacgaggcgatcgtc
gcgcacttccagccgaagcggctcgcgcaccggcgcgtgctgatcacggccggcccgacg
ttcgagccgctcgaccccgtgcgcgggctgaccaaccgctcgagcggcaagatgggcttc
gcgctcgcgcgcgcggcgcagcaggccggcgcggaggtgcacctgatcgccggcccggtc
ggcctcgcgacgccgtggggcgtctaccgcgaggacgtgcagaccgcgcagcagatgtac
gacgcggtcatgaacgcggtgcccgacgccgacatcttcatcgcggtggccgcggtggcc
gactggcgcgcggcgcagccggccgagcacaagatgaagaagaccgccgaccgcaagatg
cccgagctgacgttcgtcgagaacccggacatcctcgcgacggtcgcggccctccccgat
ccgccgttctgcgtcggcttcgcggcggaaagcggcgatctcgacgtgcacggcgacgag
aagcgcaagcgcaagaacgtgccgctgctcgtcggcaacctcggcccgcagacgttcggc
cgcgacgacaacgaagtcgcgctgttcgacgcggccggcatcacgtgcctgccgcgcgcg
ccgaaggacgcactcgcgcacgtgctcgtcgacgaaatcgcgaagcgcctgcccgacaac
agcctgatctga

DBGET integrated database retrieval system