KEGG   Bacillus subtilis subsp. subtilis 168: BSU00330Help
Entry
BSU00330          CDS       T00010                                 

Gene name
yabA
Definition
(RefSeq) initiation-control protein YabA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YabA KASH_CCD DegS UPF0242 TSC22 DUF4686 Herpes_BLRF2 Uso1_p115_C GAS DUF3450 XRCC4 Spc7 DUF2205 NRBF2 ATG16 IFT57 bZIP_1 Profilin SlyX KLRAQ DHR10 ZapB Syntaxin-6_N Cnn_1N CorA Nucleoporin2 FlxA CENP-H APC_N_CC Herpes_UL6 Phage_GP20 Mod_r V_ATPase_I DUF1664 TMPIT Cep57_CLD_2 TMF_TATA_bd Seryl_tRNA_N
Motif
Other DBs
NCBI-GeneID: 937008
NCBI-ProteinID: NP_387914
Pasteur: BG10097
BSORF: BG10097
UniProt: P37542
Structure
PDB: 

Position
42499..42858
Genome map
AA seq 119 aa AA seqDB search
MDKKELFDTVINLEEQIGSLYRQLGDLKQHIGEMIEENHHLQLENKHLRKRLDDTTQQIE
KFKADKKESKTQKTEQTDIGEGYDNLARLYQEGFHICNVHYGSVRKEDCLFCLSFLNKK
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
ttggataaaaaagagttatttgatacagtcattaacttagaagaacaaattggctcactg
taccggcagctgggggatttgaagcagcatatcggtgagatgattgaggaaaatcatcat
ttacagcttgaaaacaagcatttgcgcaaacggctggacgatacgacgcagcagattgaa
aagttcaaagctgataaaaaagaatcaaaaacacagaagacagagcaaactgatataggg
gaaggatatgataatctggcacgtctgtatcaagaaggatttcatatctgcaatgtccac
tatggaagtgttcgaaaagaggattgtcttttctgtctgtcattcttaaataaaaaatag

DBGET integrated database retrieval system