KEGG   Bacillus subtilis subsp. subtilis 168: BSU00330
Entry
BSU00330          CDS       T00010                                 
Symbol
yabA
Name
(RefSeq) initiation-control protein YabA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YabA KASH_CCD DegS UPF0242 TSC22 DUF4686 Herpes_BLRF2 DUF5917 XRCC4 IFT57 DUF3450 ATG16 DUF6674 bZIP_1 Nuf2_DHR10-like SlyX DUF2205 Cnn_1N EzrA Profilin Uso1_p115_C Nucleoporin2 ERM_helical ZapB FUSC-like Syntaxin-6_N CorA Herpes_UL6 NRBF2 V_ATPase_I Phage_GP20 TMPIT Mod_r CENP-H DUF1664 FlxA Cep57_CLD_2 Ax_dynein_light ERM_C
Other DBs
NCBI-GeneID: 937008
NCBI-ProteinID: NP_387914
Pasteur: BG10097
BSORF: BG10097
UniProt: P37542 A0A6M4JEH4
Structure
Position
42499..42858
AA seq 119 aa
MDKKELFDTVINLEEQIGSLYRQLGDLKQHIGEMIEENHHLQLENKHLRKRLDDTTQQIE
KFKADKKESKTQKTEQTDIGEGYDNLARLYQEGFHICNVHYGSVRKEDCLFCLSFLNKK
NT seq 360 nt   +upstreamnt  +downstreamnt
ttggataaaaaagagttatttgatacagtcattaacttagaagaacaaattggctcactg
taccggcagctgggggatttgaagcagcatatcggtgagatgattgaggaaaatcatcat
ttacagcttgaaaacaagcatttgcgcaaacggctggacgatacgacgcagcagattgaa
aagttcaaagctgataaaaaagaatcaaaaacacagaagacagagcaaactgatataggg
gaaggatatgataatctggcacgtctgtatcaagaaggatttcatatctgcaatgtccac
tatggaagtgttcgaaaagaggattgtcttttctgtctgtcattcttaaataaaaaatag

DBGET integrated database retrieval system