KEGG   Bacillus subtilis subsp. subtilis 168: BSU00550
Entry
BSU00550          CDS       T00010                                 

Gene name
mfd
Definition
(RefSeq) transcription-repair-coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:3.6.4.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    BSU00550 (mfd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU00550 (mfd)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     BSU00550 (mfd)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     TRCF (transcription-repair coupling factor)
      BSU00550 (mfd)
SSDB
Motif
Pfam: CarD_CdnL_TRCF UvrB_inter TRCF Helicase_C DEAD ResIII UB2H RecG_C
Other DBs
NCBI-GeneID: 936653
NCBI-ProteinID: NP_387936
Pasteur: BG10118
BSORF: BG10118
UniProt: P37474 A0A6M4JE64
Position
60430..63963
AA seq 1177 aa
MDNIQTFIKESDDFKSIINGLHEGLKEQLLAGLSGSARSVFTSALANETNKPIFLITHNL
YQAQKVTDDLTSLLEDRSVLLYPVNELISSEIAVASPELRAQRLDVINRLTNGEAPIVVA
PVAAIRRMLPPVEVWKSSQMLIQVGHDIEPDQLASRLVEVGYERSDMVSAPGEFSIRGGI
IDIYPLTSENPVRIELFDTEVDSIRSFNSDDQRSIETLTSINIGPAKELIIRPEEKARAM
EKIDSGLAASLKKLKADKQKEILHANISHDKERLSEGQTDQELVKYLSYFYEKPASLLDY
TPDNTLLILDEVSRIHEMEEQLQKEEAEFITNLLEEGKILHDIRLSFSFQKIVAEQKRPL
LYYSLFLRHVHHTSPQNIVNVSGRQMQSFHGQMNVLAGEMERFKKSNFTVVFLGANKERT
QKLSSVLADYDIEAAMTDSKKALVQGQVYIMEGELQSGFELPLMKLAVITEEELFKNRVK
KKPRKQKLTNAERIKSYSELQIGDYVVHINHGIGKYLGIETLEINGIHKDYLNIHYQGSD
KLYVPVEQIDQVQKYVGSEGKEPKLYKLGGSEWKRVKKKVETSVQDIADDLIKLYAEREA
SKGYAFSPDHEMQREFESAFPYQETEDQLRSIHEIKKDMERERPMDRLLCGDVGYGKTEV
AIRAAFKAIGDGKQVALLVPTTILAQQHYETIKERFQDYPINIGLLSRFRTRKEANETIK
GLKNGTVDIVIGTHRLLSKDVVYKDLGLLIIDEEQRFGVTHKEKIKQIKANVDVLTLTAT
PIPRTLHMSMLGVRDLSVIETPPENRFPVQTYVVEYNGALVREAIERELARGGQVYFLYN
RVEDIERKADEISMLVPDAKVAYAHGKMTENELETVMLSFLEGESDVLVSTTIIETGVDI
PNVNTLIVFDADKMGLSQLYQLRGRVGRSNRVAYAYFTYRRDKVLTEVAEKRLQAIKEFT
ELGSGFKIAMRDLTIRGAGNLLGAQQHGFIDSVGFDLYSQMLKEAIEERKGDTAKTEQFE
TEIDVELDAYIPETYIQDGKQKIDMYKRFRSVATIEEKNELQDEMIDRFGNYPKEVEYLF
TVAEMKVYARQERVELIKQDKDAVRLTISEEASAEIDGQKLFELGNQYGRQIGLGMEGKK
LKISIQTKGRSADEWLDTVLGMLKGLKDVKKQTISST
NT seq 3534 nt   +upstreamnt  +downstreamnt
atggacaacattcaaacctttataaaagaaagcgatgactttaaatccatcatcaacggt
ttacacgagggcctgaaggaacagctgctcgcgggtctgtcgggttccgcgcgttctgtt
tttacttctgctctggctaatgaaacgaataagcctatctttctcatcacccataactta
tatcaagcccagaaagtaacagatgatctgacttcacttctagaggatcggtctgtcctt
ttgtaccccgtcaatgaactcatttcatcagaaatcgcagttgcaagccctgaattgcgg
gcgcagcgattagatgtcattaatagactaacgaatggagaagcgccaattgtcgttgct
ccggtagctgcaatcagaagaatgctgccgcctgttgaggtgtggaaaagcagccagatg
ctcattcaagtaggccatgatattgaacctgaccagcttgcctcacggctggtagaggta
gggtatgagcggtctgatatggtttctgcgcccggggaattcagtattcgcgggggaatc
attgacatttatccgctgacttcagagaatccggtgagaattgaactttttgacaccgag
gtggattcaatccgcagctttaattcagatgatcagcggtcaattgagacccttacctcg
atcaatatcggtcccgcgaaggaattaattatcagaccggaagaaaaagcgcgggcgatg
gagaaaatcgatagtggtcttgccgcgagcttgaaaaaattaaaggctgacaaacaaaaa
gaaatacttcatgcgaatatttctcacgataaagaacgcttgtctgaaggccagacagat
caggagctcgtgaagtatctctcatatttctatgaaaagcctgctagtttactagattat
acacctgataatacacttctgattttggatgaagtcagtcggattcatgagatggaagaa
cagcttcaaaaagaagaagcggagtttataacaaatcttcttgaggaagggaagattttg
catgacattcgtttgtcattcagcttccaaaaaatagtggctgagcaaaaacggcctctg
ctgtactactctttatttttgcggcatgtacaccatacgagcccgcaaaatatcgtcaat
gtgtcaggccggcaaatgcagagtttccatggccaaatgaacgtgcttgcgggcgaaatg
gagcgttttaaaaaatcaaatttcactgttgtgttcttaggagcaaacaaggaacgtacg
cagaaattgtcatctgttttggctgattatgatatcgaggccgccatgacagacagcaaa
aaagcgcttgttcagggacaggtctatatcatggaaggcgagctccaatcgggatttgag
ctgccgttaatgaagcttgccgttatcacggaagaagaactgttcaaaaaccgtgtaaag
aagaagccgcgaaaacagaagcttaccaatgcagagcgcatcaaaagctattctgagctt
caaattggagattatgtcgttcatattaatcacgggatcggaaaatacctggggattgaa
actcttgaaatcaacggcattcataaagactatttaaatatacattatcagggcagtgac
aagctttacgtccctgtagaacaaattgatcaggtccaaaaatatgttggctccgaagga
aaagagccaaagctgtataaattaggcggaagtgaatggaagcgggtcaagaaaaaagta
gagacatccgttcaggatattgctgatgacttaattaagctgtatgccgaaagagaagcg
agcaagggctatgcgttttctcctgaccatgagatgcagcgtgaattcgaatcggctttc
ccttatcaagagactgaggatcagctccgttctattcacgaaatcaaaaaagacatggaa
agagaacgtccgatggaccgcttgctgtgcggagatgtgggctacggtaaaacagaggtt
gccatacgtgccgcgtttaaggcgatcggtgacggaaagcaggtagctctgctcgttccg
acaaccattttggcacagcagcactatgaaaccataaaagagcgcttccaggactatccg
attaatatcggccttctcagcaggttcagaacgagaaaagaagcaaacgaaacaatcaaa
gggctgaaaaatggaacggttgatatcgtcatcgggacgcatcggctgctatcaaaggat
gtcgtgtataaagacttagggctcctcatcattgatgaagagcagcgtttcggtgtaacc
cataaagaaaagatcaagcaaataaaagccaatgttgatgtattaacgttaacagcaacg
ccgattccgcgtacgctgcatatgtctatgcttggcgtaagggacctttcagtcatcgag
actccgccggaaaatcgcttccccgtacagacgtatgttgtggaatataacggcgctctt
gtcagagaggcgattgaacgtgagcttgcacgcggaggccaggtctatttcttgtacaac
cgggtagaggacattgagcggaaagcggatgaaatttcaatgctagtccctgacgcgaag
gtagcatatgcgcatgggaaaatgacagaaaatgaattagaaaccgttatgctaagcttc
cttgaaggagaatcagacgttctcgtcagcacaaccattatcgaaactggcgtggacatc
ccaaacgtcaatacgctgatcgtatttgacgccgacaagatgggactttctcagctttac
cagctgcgggggcgtgtcggccgttctaaccgtgtggcgtatgcgtacttcacgtatcgc
cgggataaagtgctgacagaagtggctgaaaaaaggctgcaggctattaaagaattcaca
gagttaggttccggttttaaaatcgcaatgcgtgacttaacgattcgcggagccgggaat
cttcttggtgcccagcagcatggcttcatcgattcggtcggatttgacctctattcacaa
atgctgaaggaggccattgaggagcgtaaaggagacacagcgaagacagagcagtttgaa
acagaaattgatgtcgagcttgatgcgtatattccggaaacttatattcaagacggcaaa
cagaaaattgatatgtataaacgcttcaggtctgtggcgacaatcgaagagaagaatgag
cttcaagatgaaatgatcgaccgctttggaaactatccaaaagaagtcgaatacttgttt
actgttgcagaaatgaaagtctatgcgagacaggaacgtgtcgagctgattaagcaggat
aaagatgctgtcagattgacgatttctgaagaagcaagtgctgaaattgacgggcagaag
ctgtttgagcttggcaatcaatatggcagacaaatcggactgggaatggaagggaaaaaa
ctcaaaatctccatacagacgaaaggccgtagtgctgatgaatggctcgacaccgtgctg
ggcatgctgaagggcttaaaagatgtgaaaaagcaaaccatttcatcaacgtaa

DBGET integrated database retrieval system