KEGG   Bacillus subtilis subsp. subtilis 168: BSU00810Help
Entry
BSU00810          CDS       T00010                                 

Gene name
dusB
Definition
(RefSeq) tRNA-dihydrouridine synthase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dus His_biosynth Oxidored_FMN DHO_dh NMO NanE PEP_mutase MR_MLE_C FMN_dh Nif11 ThiG SOR_SNZ G3P_antiterm TIM
Motif
Other DBs
NCBI-GeneID: 936924
NCBI-ProteinID: NP_387962
Pasteur: BG10143
BSORF: BG10143
UniProt: P37567
Position
87634..88635
Genome map
AA seq 333 aa AA seqDB search
MFKIGDIQLKNRVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSDKAILYNNARTMGMLY
IDEREKPLSLQIFGGKKETLVEAAKFVDQNTTADIIDINMGCPVPKITKCDAGAKWLLDP
DKIYEMVSAVVDAVNKPVTVKMRMGWDEDHIFAVKNAQAVERAGGKAVALHGRTRVQMYE
GTANWDIIKEVKQSVSIPVIGNGDVKTPQDAKRMLDETGVDGVMIGRAALGNPWMIYRTV
QYLETGKLKEEPQVREKMAVCKLHLDRLIDLKGENVAVREMRKHAAWYLKGVKGNANVRN
EINHCETREEFVQLLDAFTVEVEAKELQNAKVG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
ttgttcaaaatcggagatattcaattgaaaaaccgggttgtgctcgcacctatggctggt
gtctgcaactctgcgttcagattgactgtaaaggaattcggagccggattggtatgcgct
gaaatggtcagtgacaaagcgatcctttacaacaatgcaagaacaatgggtatgctttat
attgatgaacgtgagaaaccactgagccttcaaattttcggaggaaaaaaggaaaccctt
gtggaagcggcgaagtttgtagaccaaaacacaactgctgatatcattgatattaacatg
ggatgtcccgtgccgaagattacaaaatgcgatgcgggagccaaatggcttctcgatcct
gataagatttacgaaatggtttctgcagtagtggatgctgttaataagccagttacagtg
aaaatgagaatgggctgggatgaagaccacattttcgcagtgaaaaatgcacaggctgta
gaacgtgcgggcggtaaagcagtggcgcttcacggccgtacgagagtgcagatgtacgaa
ggaacggcaaactgggatatcatcaaagaagtaaaacaatcagtatcgattccggttatc
ggaaacggcgatgttaagacaccgcaggatgctaagcgtatgctcgatgagacaggagta
gacggggtcatgatcggacgcgctgcattgggtaacccgtggatgatttaccgtacggtt
cagtatcttgaaacaggtaaattaaaagaagagccgcaagtacgcgaaaaaatggccgta
tgcaaactgcatcttgaccgcctgattgacttaaaaggtgaaaacgtagcggtaagagaa
atgagaaagcacgctgcatggtatctgaaaggcgtgaaaggcaatgcgaacgttcgtaat
gaaatcaatcattgcgagacgagagaagagtttgtacagcttttagatgcatttacggtt
gaagttgaggcaaaagagcttcaaaatgcaaaagtaggataa

DBGET integrated database retrieval system