KEGG   Bacillus subtilis subsp. subtilis 168: BSU01410Help
Entry
BSU01410          CDS       T00010                                 

Gene name
rpsM
Definition
(RefSeq) 30S ribosomal protein S13
  KO
K02952  small subunit ribosomal protein S13
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01410 (rpsM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01410 (rpsM)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    BSU01410 (rpsM)
  Archaea
    BSU01410 (rpsM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S13 FbpA IMS_HHH
Motif
Other DBs
NCBI-GeneID: 938928
NCBI-ProteinID: NP_388022
Pasteur: BG10730
BSORF: BG10730
UniProt: P20282
Position
147973..148338
Genome map
AA seq 121 aa AA seqDB search
MARIAGVDIPRDKRVVISLTYIFGIGRTTAQQVLKEAGVSEDTRVRDLTEEELGKIRDII
DKLKVEGDLRREVSLNIKRLIEIGSYRGIRHRRGLPVRGQNSKNNARTRKGPRRTVANKK
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtattgctggtgtagatatcccacgtgacaaacgtgttgttatttctttaaca
tacatcttcggaattggccgcacaacggctcagcaagttttaaaagaagctggagtttca
gaagatactcgtgtgcgcgatcttactgaagaagaacttggtaaaatccgtgatattatt
gacaaactgaaagtagaaggtgaccttcgccgtgaagtttctcttaatatcaaacgtctg
atcgaaatcggaagctaccgcggaatccgtcatcgcagaggattacctgttcgcggacaa
aactctaaaaacaacgcgcgtactcgtaaaggtccgcgtcgtactgtagctaacaagaaa
aaataa

DBGET integrated database retrieval system