KEGG   Bacillus subtilis subsp. subtilis 168: BSU01580
Entry
BSU01580          CDS       T00010                                 
Symbol
ybaR
Name
(RefSeq) sulfate transporter YbaR
  KO
K03321  sulfate permease, SulP family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU01580 (ybaR)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU01580 (ybaR)
SSDB
Motif
Pfam: Sulfate_transp STAS MFS_MOT1 SafA STAS_2
Other DBs
NCBI-GeneID: 938890
NCBI-ProteinID: NP_388039
Pasteur: BG11562
BSORF: BG11562
UniProt: P55189 A0A6M4JF66
Position
177083..178519
AA seq 478 aa
MNNSFTLKQQWFGNIRKDILAGILVALALIPEAIGFSIIAGVDPMVGLYASFCIAIIISI
FGGRPGMISAATGSMAVVMVSLVADHGLQYLFAATILTGIIQVILGISKIARLMKFIPRS
VMIGFVNALAILIFSAQLPQFEGASWSMYAMLAGSLVIIYVLPRFTTAVPSPLVAIIVMT
IIAVTFHVDVRTVGDMGNISSSLPHFLIPDVPFTFETLQIIFPYSIALAFVGLLESLLTA
QIIDEMTDTDSDKNKESRGQGIANIVTGFFGGMAGCAMIGQSVINTKAGGRGRLSAFVAG
AFLMFLIAVLSHVVVKIPMAALVAVMVMVSVGTFDWSSLKGLKKAPLTDSIVMVVTVVTV
VVTDDLSKGVFVGVLLSAVFFVAKISKLKIVSHAEDQKLRTYQVKGQIFFASVTDLTNAF
IYQEDIERVVIDLTEAHVWDDSGAAALDKIVAKFKEQGIEAELKGLNKASKSLMKQMA
NT seq 1437 nt   +upstreamnt  +downstreamnt
ttgaataatagttttacattaaaacagcaatggttcgggaatatccgaaaagacattctt
gctggcattttagttgcgttagcgttaatacctgaagcgattggcttttctattatagcc
ggtgtggatccgatggtcggtctttatgcgtcattttgcatagccattattatttctatt
tttggtggcagacctggcatgatttcagctgcgacaggctcaatggcagtcgttatggtg
tcgctggttgctgatcatgggcttcagtatttatttgcggctacgattttgacaggcatt
attcaggtgattttaggtatcagtaaaattgcaagattaatgaaattcatcccgcgttct
gtgatgatcgggtttgtgaatgcgctggcgatccttatcttctctgcgcagcttccccag
tttgaaggtgcttcttggagcatgtatgcgatgcttgccgggtcgttggttattatttat
gtgctgccaaggtttacgactgctgttccgtctccgcttgtggcgattattgtgatgaca
attattgcggtcactttccatgtggatgtgcggacggttggtgatatgggcaatatttct
agttcattgcctcatttcttaatccctgatgttccgtttacctttgaaacactgcaaatt
atttttccttattcaattgctttagcgtttgtcgggttgcttgaatctttgctgacagca
cagattattgatgaaatgacggatacggatagtgataaaaataaagagagccgcggacag
ggaattgcgaatatcgtgactggattctttggcggaatggcaggctgcgctatgatcgga
caatctgtcattaatacaaaagcgggcggtcgcggacgtttgtcagcatttgttgccggt
gcttttctgatgtttttaattgcggtgttaagtcatgtcgtggtgaaaatcccaatggcg
gcgttagtagctgtaatggttatggtgtctgtcggcacttttgattggtcttctttaaaa
ggtctcaaaaaagcgccgctcacggactcgattgtcatggttgtgactgtggttacggtt
gttgtgacggatgacttatctaagggtgtatttgtcggtgttcttttaagtgccgtgttc
tttgtagcaaaaatctcgaagctgaaaatcgtttctcatgcagaggatcaaaagcttaga
acgtatcaagtgaaggggcaaatcttttttgcgtcagtgactgatcttacgaatgcgttt
atatatcaagaggatattgagcgggttgtgattgacttaactgaagctcacgtatgggac
gattctggtgcggccgcacttgataagattgttgcgaagtttaaggaacaaggcattgaa
gctgagttaaaaggtttgaataaagcgagtaaatctctaatgaaacagatggcataa

DBGET integrated database retrieval system