KEGG   Bacillus subtilis subsp. subtilis 168: BSU01990
Entry
BSU01990          CDS       T00010                                 

Symbol
ybdG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Phytoreo_S7 Abhydrolase_6
Other DBs
NCBI-GeneID: 938500
NCBI-ProteinID: NP_388081
Pasteur: BG12722
BSORF: BG12722
UniProt: O31431 A0A6M4JEW9
Position
220279..221256
AA seq 325 aa
MKTLWKVLKIVFVSLAALVLLVSVSVFIYHHFQLNKEAALLKGKGTVVDVDGKKMNVYQE
GSGKDTFVFMSGSGIAAPAYEMKGLYSKFSKENKIAVVDRAGYGYSEVSHDDRDIDTVLE
QTRKALMKSGNKPPYILMPHSISGIEAMYWAQKYPKEIKAIIAMDIGLPQQYVTYKLSGV
DRLKVRGFHLLTSIGFHRFIPSAVYNPEVIRQSFLTDEEKEIYKAINFKQFFNADMEHEL
LQSYQNGSKSVNLPAPKETPVLILDAVSDQNRHSKYAIQNRKDYEAFAAQFNTADIKELR
GTHSIYLYQPDQIYKLSMEFMRKVR
NT seq 978 nt   +upstreamnt  +downstreamnt
atgaaaacattatggaaagtcctcaaaattgtttttgtcagcttggctgctttggttttg
cttgtatccgtctcggtatttatttatcaccatttccagctaaataaggaggcggcactg
ctgaaaggtaaaggcacagtagtcgatgttgacggtaaaaagatgaatgtgtatcaagag
ggaagcgggaaggatacgtttgtgtttatgtccggttcgggtattgctgcgcctgcttat
gaaatgaaggggctgtacagcaagttttcaaaagaaaataagattgctgttgtagatcgg
gcaggttatggatacagtgaagtgtctcacgatgacagagatattgatacggtattggaa
cagacgaggaaagcgcttatgaaaagcggaaataagcctccttatattttaatgcctcat
tcgatatccgggattgaagcgatgtattgggcacagaaatatcctaaggaaatcaaggcc
attattgcgatggatattggattgccccagcagtacgtcacgtataaattgagcggagtt
gaccgattgaaagtgagagggttccacctgttaacctcgattggttttcatcggtttata
ccttccgctgtatataatcctgaggtgattcgacagtcgtttttaactgatgaagaaaaa
gaaatctataaagccattaactttaagcaattttttaatgcagatatggagcatgagctt
ttacagtcttaccaaaacggcagcaaatctgtgaatctgcctgcgccaaaggaaactccc
gtcttgattttagatgcagtctctgaccaaaatagacattcaaagtatgctatacaaaac
cgaaaagactatgaagcgtttgcggctcaattcaatactgccgatataaaggaactgagg
ggaacacacagtatttatttatatcagcctgatcaaatatataaactgtccatggagttt
atgagaaaggttcgctag

DBGET integrated database retrieval system