KEGG   Bacillus subtilis subsp. subtilis 168: BSU02070
Entry
BSU02070          CDS       T00010                                 

Symbol
csgA
Name
(RefSeq) sigma-G-dependent sporulation-specific SASP protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CsgA SieB RIC1 FAM192A_Fyv6_N
Other DBs
NCBI-GeneID: 938448
NCBI-ProteinID: NP_388089
Pasteur: BG11504
BSORF: BG11504
UniProt: P54379 A0A6M4JEF3
Position
228066..228314
AA seq 82 aa
MDVTLGYLRESLSNHLENEVCQRICKKMLAKRYANEEEFVKDLDDNEMSFLNHVLEKEIK
YAQNEQDQKRAKELNEVYELLL
NT seq 249 nt   +upstreamnt  +downstreamnt
atggatgttacactcggttatttgcgcgaatcactttcgaatcatctagaaaatgaagtc
tgccagcgtatttgcaagaagatgctggcgaagcgttatgcaaatgaagaggaatttgta
aaagacttagatgataatgaaatgtcttttttgaaccatgtattagaaaaagaaattaag
tatgcccagaatgaacaggatcaaaaacgggccaaggaattaaacgaggtgtatgaatta
ctgctttga

DBGET integrated database retrieval system