KEGG   Bacillus subtilis subsp. subtilis 168: BSU02530
Entry
BSU02530          CDS       T00010                                 

Symbol
rtpA
Name
(RefSeq) tryptophan RNA-binding attenuator protein inhibitory protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Anti-TRAP DnaJ_CXXCXGXG HypA Lar_restr_allev DUF5351 DUF1356
Other DBs
NCBI-GeneID: 938403
NCBI-ProteinID: NP_388135
Pasteur: BG12776
BSORF: BG12776
UniProt: O31466 A0A6M3Z7M0
Structure
Position
277160..277321
AA seq 53 aa
MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
NT seq 162 nt   +upstreamnt  +downstreamnt
atggtcattgcaactgatgatcttgaggtcgcatgtcctaaatgtgaaagagcgggagaa
atcgaaggaacaccttgcccggcctgcagcggaaaaggtgttattctgactgctcaagga
tatacgcttctcgattttatccaaaagcatttgaataagtaa

DBGET integrated database retrieval system