KEGG   Bacillus subtilis subsp. subtilis 168: BSU02730Help
Entry
BSU02730          CDS       T00010                                 

Gene name
natK
Definition
(RefSeq) sensor histidine kinase
  KO
K11640  two-component system, LytTR family, sensor histidine kinase NatK [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Module
bsu_M00494  NatK-NatR (sodium extrusion) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU02730 (natK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU02730 (natK)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU02730 (natK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU02730 (natK)
Protein kinases [BR:bsu01001]
 Histidine kinases
  LytTR family [OT]
   BSU02730 (natK)
Two-component system [BR:bsu02022]
 LytTR family
  NatK-NatR [MD:M00494]
   BSU02730 (natK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c_5 HATPase_c Wzy_C
Motif
Other DBs
NCBI-GeneID: 938382
NCBI-ProteinID: NP_388155
Pasteur: BG11997
BSORF: BG11997
UniProt: P70954
Position
complement(294615..295571)
Genome map
AA seq 318 aa AA seqDB search
MITLFQCLYLILFSFICYQGAAAFSHSTAASWLAAALGAAAAGLYIWNTKRVWKHCSSGL
CAWIAVIQVMSVGVVLIGTDIMPVLCVIAIFAGCEGLRIGQSALQARLSDQIDKLTQAEQ
HANQMLIDVRSRNHDTMKHITAIKSAQPKADTQAYIQNWADQYSQYDRFLKGENAYVAGV
LYDFLEKARASNVSVSLHMHTPLSSLPFSPADQVSLVGNILENALDSAAEAREKAEIKLE
TSLRSGLYVLTCENSTPGMDPKVLDTIYQSFGRSTKNGAHEGMGTYIIQKLVKGAFGRLD
FTYRHPIFRLEIKIPFQK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgattaccctttttcaatgtctttatctgattttatttagtttcatatgttatcaggga
gctgctgctttttcacacagcacagccgcctcttggctcgccgctgctttaggcgcagct
gctgcaggattgtacatttggaatacgaagcgggtgtggaaacactgttcctcagggctt
tgtgcgtggattgcggtgattcaagtgatgtcggtgggagtggtgttgattggcacagac
atcatgccggtattatgtgtaatcgcgatatttgcagggtgtgaagggctccgtatcgga
cagtctgctttgcaggcaaggctttctgatcaaattgataagctgactcaagctgaacag
cacgccaatcaaatgctgattgatgtcagaagccggaatcatgacacaatgaaacatatc
actgcaatcaaatcagctcagcccaaggcagatacacaagcatatattcaaaactgggcg
gatcaatacagccaatatgaccgttttttgaaaggagagaacgcgtacgttgcaggggtg
ctttatgattttttagaaaaagcccgcgcctcgaatgtgagtgtttcgctgcatatgcat
acaccgctttcttcccttccgttttcgcctgctgatcaggtcagcttggtcggcaacata
ttagaaaatgcgctcgacagcgcggcggaggcccgagaaaaagcagagattaaactggag
acttcactgcgcagcgggctttatgtactgacttgtgaaaacagcactcccgggatggac
ccaaaagtgctcgatacaatttatcaatcgtttggccgctcaacgaaaaacggcgctcat
gaaggcatgggcacatatatcattcaaaaactggtgaagggcgcttttggcaggctggat
tttacctaccgccaccccatcttccggttagaaatcaaaattccgtttcagaaataa

DBGET integrated database retrieval system