KEGG   Bacillus subtilis subsp. subtilis 168: BSU03200Help
Entry
BSU03200          CDS       T00010                                 

Gene name
ycgM
Definition
(RefSeq) proline dehydrogenase 2
  KO
K00318  proline dehydrogenase [EC:1.5.5.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00330  Arginine and proline metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BSU03200 (ycgM)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     BSU03200 (ycgM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_dh DUF711
Motif
Other DBs
NCBI-GeneID: 938338
NCBI-ProteinID: NP_388202
Pasteur: BG12011
BSORF: BG12011
UniProt: P94390
Position
344551..345462
Genome map
AA seq 303 aa AA seqDB search
MITRDFFLFLSKSGFLNKMARNWGSRVAAGKIIGGNDFNSSIPTIRQLNSQGLSVTVDHL
GEFVNSAEVARERTEECIQTIATIADQELNSHVSLKMTSLGLDIDMDLVYENMTKILQTA
EKHKIMVTIDMEDEVRCQKTLDIFKDFRKKYEHVSTVLQAYLYRTEKDIDDLDSLNPFLR
LVKGAYKESEKVAFPEKSDVDENYKKIIRKQLLNGHYTAIATHDDKMIDFTKQLAKEHGI
ANDKFEFQMLYGMRSQTQLSLVKEGYNMRVYLPYGEDWYGYFMRRLAERPSNIAFAFKGM
TKK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgatcacaagagattttttcttatttttatccaaaagcggctttctcaataaaatggcg
aggaactggggaagtcgggtagcagcgggtaaaattatcggcgggaatgactttaacagt
tcaatcccgaccattcgacagcttaacagccaaggcttgtcagttactgtcgatcattta
ggcgagtttgtgaacagcgccgaggtcgcacgggagcgtacggaagagtgcattcaaacc
attgcgaccatcgcggatcaggagctgaactcacacgtttctttaaaaatgacgtcttta
ggtttggatatagatatggatttggtgtatgaaaatatgacaaaaatccttcagacggcc
gagaaacataaaatcatggtcaccattgacatggaggacgaagtcagatgccagaaaacg
cttgatattttcaaagatttcagaaagaaatacgagcatgtgagcacagtgctgcaagcc
tatctgtaccggacggaaaaagacattgacgatttggattctttaaacccgttccttcgc
cttgtaaaaggagcttataaagaatcagaaaaagtagctttcccggagaaaagcgatgtc
gatgaaaattacaaaaaaatcatccgaaagcagctcttaaacggtcactatacagcgatt
gccacacatgacgacaaaatgatcgactttacaaagcagcttgccaaggaacatggcatt
gccaatgacaagtttgaatttcagatgctgtacggcatgcggtcgcaaacccagctcagc
ctcgtaaaagaaggttataacatgagagtctacctgccatacggcgaggattggtacggc
tactttatgagacgccttgcagaacgtccgtcaaacattgcatttgctttcaaaggaatg
acaaagaagtaa

DBGET integrated database retrieval system