KEGG   Bacillus subtilis subsp. subtilis 168: BSU03320Help
Entry
BSU03320          CDS       T00010                                 

Gene name
nasB
Definition
(RefSeq) assimilatory nitrate reductase electron transfer subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00910  Nitrogen metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Module
bsu_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSU03320 (nasB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     BSU03320 (nasB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD Pyr_redox Rubredoxin_C Pyr_redox_3 NIR_SIR_ferr HI0933_like AlaDh_PNT_C 3HCDH_N GIDA Amino_oxidase
Motif
Other DBs
NCBI-GeneID: 938328
NCBI-ProteinID: NP_388214
Pasteur: BG11094
BSORF: BG11094
UniProt: P42433
Position
complement(360442..362757)
Genome map
AA seq 771 aa AA seqDB search
MKKQRLVLAGNGMAGIRCIEEVLKLNRHMFEIVIFGSEPHPNYNRILLSSVLQGEASLDD
ITLNSKDWYDKHGITLYTGETVIQIDTDQQQVITDRKRTLSYDKLIVATGSSPHILPIPG
ADKKGVYGFRTIEDCQALMNMAQHFQKAAVIGAGLLGLEAAVGLQHLGMDVSVIHHSAGI
MQKQLDQTAARLLQTELEQKGLTFLLEKDTVSISGATKADRIHFKDGSSLKADLIVMAAG
VKPNIELAVSAGIKVNRGIIVNDFMQTSEPNIYAVGECAEHNGTVYGLVAPLYEQGKALA
SHICGVPCEEYQGSAPSAALKIAGIDVWSAGKIQEDERTTSIKIYDEQAGVYKKALFVDD
KLAGVILFGDTRDKQRLLDSLLKQRDISIAKKQIIEPETSGPLFESMPSSETICQCNTVT
KGAIEDAVHTNSLTTVEEVKHCTKATGSCGGCKPLVEDLLRYMTNSEYTKPASTPSFCSC
TDFTEDDIIAELQRRPFTNPAEVMNQLDWKTKNGCSTCVPAIQYYLEMLYPGFVQPEPAT
EETCILIPQMYGGRTNAEQLRTIANIIEAYSIPDVSITHGQRLKLSGIKPADLPNMKKDL
KMPVYTNEHRHALQSIKACTCGQNRSIQQLAAQIERQLEMLPLPAPISISLSCETDCTEA
ALQDVGAIRTQAGWDIHIGGVRGTHARSGALFCVTENEDSTAGMIKGLIQYYRETAHYLE
GVHQWIDRLGIVHIREVLFEEDLRAQLLESLQTDLSLIQNPTVETGAYKKG
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacaaagattagtgttagcgggaaacggcatggccggaatccgctgtattgaa
gaagtattaaagctgaatcgccacatgtttgagattgtcattttcggaagcgagccgcat
cccaattacaatcgcattctcttatcctctgtattgcagggtgaagcgtcactcgatgat
attacactgaacagcaaggattggtacgacaagcacgggatcacgctttacacaggcgaa
acggttattcagattgatacagatcagcagcaggtcatcacagatcggaaacgcactctg
tcgtatgacaaattaatagtggcaacaggctcctcccctcatattctccctatccccggg
gcagacaaaaaaggtgtctatggatttcggacaatagaagactgccaagcgctgatgaac
atggcccagcactttcaaaaggctgcggtaatcggagccggcttattaggactggaagct
gcagtaggtttacagcatctcggtatggatgtcagcgtcattcaccactccgccggcatt
atgcaaaaacagctcgatcaaacagcggcgcggctgctgcaaacagagctggaacaaaaa
ggcctaacctttcttttggagaaagacaccgtctccatttccggcgccacgaaggcagac
cgaatccattttaaagatggctcttcattaaaagcagacttgattgtgatggcggccggc
gtcaaaccgaatattgaattggctgtatccgctggaatcaaagtgaaccgcgggatcatc
gtgaatgacttcatgcagacaagcgaaccgaatatctacgccgttggtgaatgcgctgag
cataacggaacggtgtacggattggtggctccgctttatgagcagggaaaagcgctcgcc
agtcatatttgcggcgttccatgtgaggaatatcaaggctcagcaccatctgcggcgtta
aaaatagctggaatcgatgtgtggtcagcaggaaagatccaagaggatgaacgcacgacg
agcatcaaaatctacgacgaacaagcaggcgtttataaaaaagcgctttttgtagatgac
aaactggccggcgttattttattcggagacacccgtgacaagcagcggcttctcgacagc
ctgcttaaacaacgagacatctccattgccaaaaaacagatcatcgaaccggagacaagc
ggccctttatttgaatccatgccttccagtgaaacgatttgccaatgcaacacagtgacg
aaaggcgcgattgaagacgcggtgcacacgaatagcttaacaactgttgaggaagtcaag
cactgcaccaaagccactgggtcctgcggaggatgcaaaccgctcgttgaagaccttttg
agatacatgaccaacagcgaatatacgaagcccgccagcacaccttcgttttgcagctgt
actgattttacagaagacgacatcatcgctgagcttcagcgcaggccattcactaatccg
gcagaagtgatgaaccagcttgactggaaaacaaaaaacggatgcagtacttgtgttcct
gcgattcaatactatctggaaatgctgtaccctgggtttgtccagcctgagccagccact
gaagagacatgcatcctgattccgcaaatgtacggcgggcggacaaacgcggagcagcta
agaaccatcgccaacatcattgaggcatacagcattcccgacgtatccatcactcacggc
caaaggctgaagctttccgggatcaagcctgcggatctcccgaacatgaaaaaagacctg
aaaatgcccgtttacactaatgaacaccgacacgcgctgcaaagcatcaaagcatgtaca
tgcgggcaaaatcgatcgattcagcagctggcagcccaaatcgaaagacaacttgagatg
cttcccttacccgctcccatttctatcagcttatcatgtgaaacagactgcaccgaggcc
gccctgcaagatgtcggcgcaattcggacacaagctggctgggacattcacatcggcggc
gtccggggaactcatgcccgttcaggagctttgttttgcgtgactgagaacgaagacagc
actgccggcatgatcaaaggactgatccagtattatcgggaaacggctcattacttagaa
ggtgttcatcagtggatagaccgtctcgggatcgttcatatcagagaagtgctattcgaa
gaagacctaagggcacagctgctggaaagcctccaaacagatctgtcactgattcaaaac
ccgactgtagagacgggcgcatataagaaaggatga

DBGET integrated database retrieval system