KEGG   Bacillus subtilis subsp. subtilis 168: BSU03540
Entry
BSU03540          CDS       T00010                                 

Symbol
ycxB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YcxB DUF3021 FtsX Baculo_11_kDa UstYa DUF2304 DHHC
Other DBs
NCBI-GeneID: 938305
NCBI-ProteinID: NP_388236
Pasteur: BG10173
BSORF: BG10173
UniProt: Q08793 A0A6M3ZCK6
Position
complement(404458..405015)
AA seq 185 aa
MIQYASESINLPGEITFKDVREIFFYQIAKISCFYFLLFCAIFAAVNFINGWPRIVYGSD
ALNLFMNSMLIIVMSVLFTLLLLLLLYVKFSRAYKKNERMKSKRTYTLNQEGIRICSKKY
DLIFNWDEITAVFEYKNIFRVNTSSGQYIAIPKHFFHSEEEMNRFKEIILKNTETKKLKF
KKDQH
NT seq 558 nt   +upstreamnt  +downstreamnt
atgattcaatatgctagtgaaagtatcaatcttccaggagaaatcacttttaaggatgta
agagaaatctttttttatcaaatcgcaaaaatatcatgcttttactttctattgttttgc
gccatatttgctgcagttaacttcattaacggatggccccgtatcgtttatggaagtgac
gcgcttaacttgtttatgaacagtatgttgattatcgtgatgtccgttctgtttacactg
ctgctcctccttcttctatatgtgaagttttccagagcatacaagaagaacgaacggatg
aaatccaaaagaacatatactctgaaccaagaaggaattcgtatatgttctaaaaaatat
gacctcattttcaattgggatgaaattacagctgttttcgaatataaaaatatcttcagg
gtcaatacatcaagtggccaatatattgcgatccccaaacatttttttcactccgaagag
gagatgaacagattcaaggagattatccttaaaaataccgaaacaaaaaaactcaaattt
aaaaaggatcagcattga

DBGET integrated database retrieval system