KEGG   Bacillus subtilis subsp. subtilis 168: BSU03660
Entry
BSU03660          CDS       T00010                                 

Symbol
yclE
Name
(RefSeq) AB hydrolase superfamily protein YclE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6
Other DBs
NCBI-GeneID: 938288
NCBI-ProteinID: NP_388248
Pasteur: BG12026
BSORF: BG12026
UniProt: P94407 A0A6M4JK04
Position
415350..416195
AA seq 281 aa
MERAGICHSDGFDLAYRIEGEGAPILVIGSAVYYPRLFSSDIKQKYQWVFVDHRGFAKPK
RELRAEDSRLDAVLADIERMRTFLQLEDVTILGHSGHAFMALEYARTYPKQVRKVALFNT
APDNSEERQRKSESFFMETASLERKKRFEKDIENLPQDIDKDPERRFVHMCIRAEAKSFY
QERPHAAALWDGVFTNMPIIDELWGNTFARIDLLQRLADVRMPVYIGLGRYDYLVAPVSL
WDAVDGLYPHVDKVIFEKSGHQPMLEEPEAFDQSFRKWLDQ
NT seq 846 nt   +upstreamnt  +downstreamnt
atggaacgtgcggggatctgtcactcggacggctttgatttagcttatcgaattgagggc
gagggcgcacccatccttgtgatcgggagtgcggtttactatccgcgccttttttcctca
gatatcaaacagaaatatcaatgggtctttgtcgaccataggggatttgctaagcctaag
cgggagcttcgtgcggaggattcgaggcttgatgctgtcttggctgatatcgaaaggatg
agaacatttcttcagcttgaggatgttactatcctgggacattccgggcacgcttttatg
gctttagagtatgccaggacatatcccaaacaagttcggaaggtggcgctctttaatact
gcgcctgataacagtgaagaaagacagcgaaaaagcgaatcatttttcatggaaacagcc
agtcttgagagaaagaaacgctttgaaaaagacatcgagaatttgccgcaggacatcgac
aaagatcctgaaaggcgctttgtgcacatgtgtattcgcgctgaagcgaaaagcttttat
caagagcggccgcatgctgctgccttatgggacggtgtattcacgaatatgccgatcatt
gatgaattatggggcaatacatttgcccggattgatcttcttcagcggttagctgatgtt
cgtatgccggtgtatatcggattagggagatatgattatttggttgcgcccgtttcgcta
tgggatgctgttgacggtttatatccccatgttgataaggttatttttgaaaagagcggc
catcagccgatgctggaagaaccggaagcctttgatcaaagcttcaggaaatggcttgat
caataa

DBGET integrated database retrieval system