KEGG   Bacillus subtilis subsp. subtilis 168: BSU03660Help
Entry
BSU03660          CDS       T00010                                 

Gene name
yclE
Definition
(RefSeq) AB hydrolase superfamily protein YclE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 938288
NCBI-ProteinID: NP_388248
Pasteur: BG12026
BSORF: BG12026
UniProt: P94407
Position
415350..416195
Genome map
AA seq 281 aa AA seqDB search
MERAGICHSDGFDLAYRIEGEGAPILVIGSAVYYPRLFSSDIKQKYQWVFVDHRGFAKPK
RELRAEDSRLDAVLADIERMRTFLQLEDVTILGHSGHAFMALEYARTYPKQVRKVALFNT
APDNSEERQRKSESFFMETASLERKKRFEKDIENLPQDIDKDPERRFVHMCIRAEAKSFY
QERPHAAALWDGVFTNMPIIDELWGNTFARIDLLQRLADVRMPVYIGLGRYDYLVAPVSL
WDAVDGLYPHVDKVIFEKSGHQPMLEEPEAFDQSFRKWLDQ
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtgcggggatctgtcactcggacggctttgatttagcttatcgaattgagggc
gagggcgcacccatccttgtgatcgggagtgcggtttactatccgcgccttttttcctca
gatatcaaacagaaatatcaatgggtctttgtcgaccataggggatttgctaagcctaag
cgggagcttcgtgcggaggattcgaggcttgatgctgtcttggctgatatcgaaaggatg
agaacatttcttcagcttgaggatgttactatcctgggacattccgggcacgcttttatg
gctttagagtatgccaggacatatcccaaacaagttcggaaggtggcgctctttaatact
gcgcctgataacagtgaagaaagacagcgaaaaagcgaatcatttttcatggaaacagcc
agtcttgagagaaagaaacgctttgaaaaagacatcgagaatttgccgcaggacatcgac
aaagatcctgaaaggcgctttgtgcacatgtgtattcgcgctgaagcgaaaagcttttat
caagagcggccgcatgctgctgccttatgggacggtgtattcacgaatatgccgatcatt
gatgaattatggggcaatacatttgcccggattgatcttcttcagcggttagctgatgtt
cgtatgccggtgtatatcggattagggagatatgattatttggttgcgcccgtttcgcta
tgggatgctgttgacggtttatatccccatgttgataaggttatttttgaaaagagcggc
catcagccgatgctggaagaaccggaagcctttgatcaaagcttcaggaaatggcttgat
caataa

DBGET integrated database retrieval system