KEGG   Bacillus subtilis subsp. subtilis 168: BSU04020
Entry
BSU04020          CDS       T00010                                 

Symbol
yczH
Name
(RefSeq) hydrolase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DLH PE-PPE DUF726 Hydrolase_4 Abhydrolase_2 Lipase_2
Other DBs
NCBI-GeneID: 938255
NCBI-ProteinID: NP_388284
Pasteur: BG12782
BSORF: BG12782
UniProt: O31482 A0A6M4JDB1
Position
complement(454652..455260)
AA seq 202 aa
MFPKPLVILAHEIYGVNSHMKKMGRLIKMAGYDVLTPNLLGEDEVYTLKEEKTAYEQFTK
HERLKTGETIIQNVIRQNAGRHIFVIGFSVGATIAWKCSSMPEVSGSVCYYGSRIRDSLH
HMPACPVLLFFPNYEPSFDVALLIKKLREKQHTHLEIYQFDALHGFANPDSVYFNRALFF
KTLSIIKNGAESRLRTVSSSFF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgttcccaaaaccgcttgtcattctcgcacacgaaatatatggtgtaaacagccatatg
aaaaagatgggccggctgatcaaaatggctggatatgatgtgttgacgcccaacctgctc
ggcgaggatgaagtctacacactgaaagaagaaaaaacggcatacgaacaatttacaaaa
cacgaaaggctgaaaacgggagaaaccatcatccagaatgtgatcaggcaaaacgccgga
cggcacatctttgtgattggattcagcgtgggggctactatcgcatggaaatgcagcagt
atgcctgaggtgagcggatcggtttgttattacggttcccggatacgcgactctcttcat
cacatgccagcctgcccggtcctattgtttttccctaattatgagccgtcgtttgacgta
gcgcttcttatcaaaaaactgcgggaaaaacagcatacccatcttgagatttaccaattc
gatgcgcttcacggcttcgccaatcctgattctgtttatttcaacagggcccttttcttc
aaaacgctttctatcataaaaaacggggcggaaagccggctccgcaccgtttcatcatca
tttttttaa

DBGET integrated database retrieval system