KEGG   Bacillus subtilis subsp. subtilis 168: BSU04310
Entry
BSU04310          CDS       T00010                                 

Symbol
ydaN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: BcsB Psg1 TRAP_beta BPA_C Orf78
Other DBs
NCBI-GeneID: 940004
NCBI-ProteinID: NP_388312
Pasteur: BG12061
BSORF: BG12061
UniProt: O31488 A0A6M3Z7N5
Position
483845..485956
AA seq 703 aa
MKQIMIFLTSFMLLAMTGQTALAKDVQVSGSLLGKSSQEQAKQQVLTSELITLYGSKDSA
ELTYQIPAGASSGNQQLVIEYEASNLLISPSSLTVVIDDEPVKTLKLDGDSKRKTVKLNL
NKSQSAQGYHNVSLKFYGVMKEGVCVRQDTSGNWIKIYPDSRLTLADSSEAKGTSLDHYP
YPFAQSGNTAEETAIVIPDNPSSAEIEAAVKTEGYLKTVDSSVSIAYVTESELKKIDKPT
IVIGVDKHWNGKVKKLLKQAGLQAKGENLLLAERVLKAEGKQQPVLFAQAASEDALTKKI
SVMTDQTYTGQLSGDTLSISKLQQTEKKESDKLTLENFGAGDITIGADKTSSAHYFYPAS
AVLDENQSAKLSLKLKKSETIQASTAENESASQAAELKVMINGQPHSVRLDELGKEDKNG
FYHVTVKVDPKLLQKNRYIDIQFVTTGLKENNPCNTTDEEKWVFIDKNSTLSYAIKGMSP
SADFQEWPLPYAGNQDQTTLIVLPDTVSQSKLEELSLVTESFGNEAQHSYTVKKSSDVTA
NDAKGRNLIFIGGINQFSLLKEKSSDLLVPQEKNGSFDVSSFEMLNETTKQVVFTQASVW
DSRYTMAVFAPSKGDGTAVTKEIISYLNSNDESATVLNETNSQQVFTNHQQLKSETNSSD
AEQPTQDHSQKWMYIGVLALIMVVAAVFIWIAVRRKKRKTDTE
NT seq 2112 nt   +upstreamnt  +downstreamnt
ttgaaacaaataatgatttttctcacaagcttcatgctgctggcgatgactggacaaacg
gctcttgccaaagacgtacaggtcagcggttcgctccttgggaaaagcagccaagaacaa
gccaaacagcaggtgctgacaagcgagctgattacactgtatggatcaaaagacagcgca
gagctgacgtatcagatcccggcaggcgcctcttcgggcaatcagcaattggtaatcgaa
tacgaggcatcaaatcttttaatttctccatcatcgttaacggttgtcattgatgatgaa
ccggtcaagacgttaaagcttgatggtgattccaaacggaaaacagtgaagctgaatctg
aataaaagccagtctgcgcaaggctatcacaacgtatcgctgaaattctacggcgtaatg
aaagagggcgtgtgcgtcagacaggatacatcaggcaactggatcaaaatttatccggac
agccggctgacacttgctgacagcagtgaagcgaagggaacgtcgctggaccattatccg
tatcctttcgcccaatctggaaatacagcggaagaaacagctatcgtcattccggataac
ccaagttcagcagaaatagaagctgctgttaaaacagaaggctatttgaaaacggtggac
agcagtgtcagtattgcgtatgtcacggaatctgaactgaaaaaaatcgataagccgacg
attgttatcggcgtggacaagcattggaacggcaaagtgaaaaaactgttgaaacaagcc
gggctacaggcaaaaggagaaaaccttctgcttgcggagcgggtgctgaaagcagagggc
aaacagcagccggttctgtttgcgcaagcggcgtccgaggacgcgctcacaaaaaaaatc
agcgtgatgacagatcagacatatacaggccagctcagcggcgatacactttcaatcagc
aagcttcagcagactgaaaaaaaagaaagcgataagctgacccttgagaattttggagcg
ggtgatatcacaattggagccgacaaaacatcttcagcacattatttttatccggcttcg
gctgttttagatgaaaaccaatcggcgaagctgtcgcttaaactgaaaaagtctgaaacg
attcaagcctcaacggctgaaaacgagtcagcctctcaggctgcagaactgaaagtgatg
atcaacggccagccgcactcggtccggcttgatgaattaggaaaagaagataaaaacgga
ttctatcatgtcacagtgaaagtggaccctaagctgctgcaaaaaaaccgctacattgat
attcagttcgtcacgaccggtttaaaggaaaacaacccttgtaacaccactgatgaagaa
aagtgggtttttatcgataaaaacagtacattatcatacgccatcaaaggcatgtccccg
tcagcggattttcaagagtggccgctgccttacgccggaaaccaggatcaaacaacgtta
atcgtgcttcctgacaccgtaagccaatcgaagctagaggagctttctctcgtaacagaa
tcctttggcaacgaagcacagcattcatatacggtaaagaaatcatctgacgttacagca
aatgatgcgaaaggacgaaacctcattttcataggagggatcaatcaattttctcttctg
aaggagaaatcatcagatctgcttgtgccgcaggaaaagaacggctcgtttgatgtatct
agtttcgagatgctgaatgagacgacaaaacaagtggtatttacccaagcatcggtttgg
gattcacgctatacaatggctgtctttgcaccgtcaaaaggagatggcacggctgtcaca
aaagagatcatcagttatctgaacagcaacgatgagtcggcaaccgtccttaatgaaaca
aacagccagcaggtgtttacaaaccaccagcagctcaaatcggaaacaaacagttccgat
gcagaacaaccaacacaggatcatagccagaaatggatgtatattggtgtgctggcactc
attatggtggttgcggcagtgttcatttggattgccgtaagacgcaaaaaaagaaagaca
gatacagaataa

DBGET integrated database retrieval system