KEGG   Bacillus subtilis subsp. subtilis 168: BSU04550
Entry
BSU04550          CDS       T00010                                 

Symbol
ydbP
Name
(RefSeq) thioredoxin
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_9 Thioredoxin_8 Thioredoxin_3 Thioredoxin_2 Thioredoxin_7 DUF953 Phosducin HyaE Thioredoxin_6 DIM1 AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 939940
NCBI-ProteinID: NP_388336
Pasteur: BG12083
BSORF: BG12083
UniProt: P96611 A0A6M4JDI1
Position
complement(507753..508073)
AA seq 106 aa
MKKITTNEQFNELIQSDKEIIVKFYADWCPDCTRMNMFIGDILEEYNQNDWYELNKDELP
DLAEKYQVMGIPSLLIFKNGEKTAHLHSANAKTPEEVTEFLSEHIS
NT seq 321 nt   +upstreamnt  +downstreamnt
atgaaaaaaatcacaacaaacgaacaatttaatgaactgattcaatctgataaagaaatc
attgtaaagttttatgctgattggtgcccagactgcacacgcatgaatatgttcatcggc
gatattttggaagaatacaaccaaaacgactggtatgagctgaataaggacgagcttcct
gacctggctgaaaaataccaagtaatgggcattcccagcctgcttattttcaagaacggt
gaaaaaacagctcaccttcacagcgccaatgccaaaacgcctgaagaagtgactgaattt
ttatctgaacatataagctaa

DBGET integrated database retrieval system