KEGG   Bacillus subtilis subsp. subtilis 168: BSU04670
Entry
BSU04670          CDS       T00010                                 

Symbol
rsbRA
Name
(RefSeq) RsbT co-antagonist protein RsbRA
  KO
K17763  rsbT co-antagonist protein RsbR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU04670 (rsbRA)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BSU04670 (rsbRA)
SSDB
Motif
Pfam: Rsbr_N STAS IpaB_EvcA STAS_2 RsbRD_N
Other DBs
NCBI-GeneID: 938176
NCBI-ProteinID: NP_388348
Pasteur: BG11090
BSORF: BG11090
UniProt: P42409 A0A6M3Z7V8
Structure
Position
519408..520232
AA seq 274 aa
MMSNQTVYQFIAENQNELLQLWTDTLKELSEQESYQLTDQVYENISKEYIDILLLSVKDE
NAAESQISELALRAVQIGLSMKFLATALAEFWKRLYTKMNDKRLPDQESTELIWQIDRFF
SPINTEIFNQYSISWEKTVSLQKIALQELSAPLIPVFENITVMPLVGTIDTERAKRIMEN
LLNGVVKHRSQVVLIDITGVPVVDTMVAHHIIQASEAVRLVGAKCLLAGIRPEIAQTIVN
LGIDLSQVITKNTLQKGIQTALEMTDRKIVSLGE
NT seq 825 nt   +upstreamnt  +downstreamnt
ttgatgtcgaaccagactgtataccagttcattgccgaaaatcaaaatgaactgctccaa
ctgtggactgacacactaaaagaattaagcgagcaagaatcctatcagctgactgaccaa
gtgtatgaaaatatatctaaagaatatatcgacattctgctgctgtctgttaaggacgaa
aatgctgctgaaagccaaatcagcgaactggcgcttcgagcggtccaaatcggactgtct
atgaagtttttggctactgcacttgccgaattctggaagcgtctctacacgaaaatgaat
gataagagattgccagatcaagagagcacggaattaatctggcagattgatcgctttttc
agcccgattaacacagaaatttttaatcaatactcaatctcatgggaaaaaacagtatcc
ctgcaaaaaatcgcgctgcaagagctgtctgcgccgcttatcccggtgtttgaaaatatc
actgtgatgcctcttgtcggaacaattgataccgaacgcgcgaaacgaattatggaaaac
cttcttaatggcgtcgtcaaacaccgttcccaagtcgtgctgattgacattacaggtgtc
cctgtcgtcgatacgatggttgcccatcatattattcaggcatcagaagctgtaaggctt
gtcggagcaaaatgcctgctggccggaatccgtccggaaattgctcaaacaatcgtcaac
ctggggattgatttatcccaagttataactaagaataccctgcaaaaaggaattcaaaca
gcattggaaatgacggatcgaaaaatcgtttcattgggggaataa

DBGET integrated database retrieval system