KEGG   Bacillus subtilis subsp. subtilis 168: BSU04820
Entry
BSU04820          CDS       T00010                                 

Symbol
immR
Name
(RefSeq) XRE family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_25 HTH_37 MqsA_antitoxin DUF2209 Glycos_transf_2 DUF2529 HTH_24 HTH_8 HTH_Tnp_1 HTH_28
Other DBs
NCBI-GeneID: 938150
NCBI-ProteinID: NP_388363
Pasteur: BG12101
BSORF: BG12101
UniProt: P96631 A0A6M3Z7S7
Position
complement(531130..531513)
AA seq 127 aa
MSLGKRLKEARQKAGYTQKEAAEKLNIGNNNLSNYERDYRDPDTDTLLKLSNLYNVSTDY
LLGKDEVSKKNETDLLNKTINEAIQELKDEDTLLFMNDGEFDEETARLVKKALKNGIKFI
DELKKKE
NT seq 384 nt   +upstreamnt  +downstreamnt
atgagcctaggcaaacgattaaaagaagctcgacaaaaagctgggtacactcagaaagaa
gccgcagagaaacttaatatcggtaacaataacttgtctaattacgaaagagattacaga
gatcctgatacagacacactcttaaaattgagcaacttatataacgtatctacagactat
ttattaggaaaggatgaagtaagcaagaaaaacgaaactgatttactcaataaaacaatt
aatgaagccatacaggaattaaaggatgaagatacactcctttttatgaatgatggtgaa
tttgatgaggaaactgcacgccttgttaaaaaagcattaaaaaacggaattaaattcatt
gacgaattaaagaagaaagagtga

DBGET integrated database retrieval system