KEGG   Bacillus subtilis subsp. subtilis 168: BSU04860
Entry
BSU04860          CDS       T00010                                 

Symbol
ydcQ
Name
(RefSeq) Ftsk domain-containing protein YdcQ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FtsK_SpoIIIE DUF87 AAA_10 TrwB_AAD_bind AAA_19 ResIII
Other DBs
NCBI-GeneID: 939923
NCBI-ProteinID: NP_388367
Pasteur: BG12104
BSORF: BG12104
UniProt: P96634 A0A6M3ZCZ2
Position
533338..534780
AA seq 480 aa
MSDFLNKRFWKYRGKRIRPYMRNNVKLAGAIIFVPVFLLSMFLFWREQLIHFDLSQVIKN
FEWNVPLIIKSVLCSVLIAVGSIVASYFLLFDSYKKILHRQKIAKMIFSNKFYEKENVKV
RKIFSNETDSKEKITYFPRMYYQVKNNHIYIRIAMDMSRFQNRFLDLGKDLENGLFCDLV
DKQMEEGFVCFKLLYDVKKNRISIDDAVAENGVLPLMKHISWQFDKLPHMLIAGGTGGGK
TYFMLTIIKACVGLGADVRILDPKNADLADLEEVLPKKVYSQKNGILMCLRKSVDGMMER
MDEMKQMSNYKTGENYAYLGLKPVFIFFDEYVAFMDLLDMKERNEALSYMKQLVMLGRQA
GYFLVLGAQRPDAKYLADGIRDQFSFRVSLGLMSDTGYGMMFGDVEKAYVNKKETGRGYA
NVGTGSVLEFYSPIVPKGYDFMSSIKNALVGVEGAQATAVASGSVSDQTASGEGVSEANG
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagtgatttcttaaacaaaagattttggaaatacaggggcaaacgaatccgcccgtac
atgagaaacaacgtaaagttagcaggcgcaatcatctttgtgcctgtttttttattgtct
atgttccttttttggagagaacaactcattcattttgatctatctcaagtgataaaaaat
tttgaatggaatgtgcctttaatcattaaaagcgttttatgctctgtgctaattgctgtt
ggaagcatagttgcatcttactttcttttgtttgacagctataagaaaatccttcacagg
caaaagattgctaaaatgattttctctaacaagttttacgaaaaagaaaacgtgaaagta
agaaaaatcttttcaaatgaaactgactcaaaggaaaagatcacatactttcctagaatg
tattaccaggtcaaaaacaaccacatctatattcgtattgctatggacatgagccgtttt
cagaatcgcttcctagacttaggaaaggatttggaaaacggcttattttgtgacttggtt
gataaacaaatggaagaaggttttgtatgctttaagcttctttacgatgtcaaaaagaat
cgtatttccattgatgatgcagtagctgagaatggagtccttccgttaatgaagcatatc
tcatggcaatttgataagttgccgcacatgcttattgctggtggtacaggtggagggaaa
acatacttcatgctaacgatcattaaggcatgtgttggactgggggcagatgtaagaata
ctagaccctaaaaatgcagatttagcagacttggaagaagtacttccgaaaaaggtctat
tcccaaaagaacggtattcttatgtgcctgagaaagtctgtagatggcatgatggaacga
atggatgaaatgaagcaaatgtctaactataagacaggtgaaaactatgcttatttaggc
ttaaaacctgtttttatcttctttgatgaatatgtggcatttatggatttgttagatatg
aaagaaagaaacgaagccctttcttacatgaaacagttggtcatgttggggagacaggcg
gggtattttctcgttttaggcgcacaacgtccagatgcaaaatatttagctgacggtatt
cgtgatcagtttagctttcgtgtttcattgggtttaatgtccgatacgggttacggaatg
atgtttggcgatgttgaaaaagcatatgtgaataaaaaggagacagggcgaggatatgcc
aatgtgggcacaggttcagtgttggagttttacagccctatcgtgccgaaaggatatgat
tttatgtcatctattaaaaatgcgctggttggagtcgagggagcgcaggcgacggcagtc
gccagcggcagcgtaagcgaccagacggccagcggcgaaggagtgagcgaagcgaatgga
tga

DBGET integrated database retrieval system