KEGG   Bacillus subtilis subsp. subtilis 168: BSU04940
Entry
BSU04940          CDS       T00010                                 

Symbol
yddE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AAA_10 DUF87 Sigma54_activat AAA_16
Other DBs
NCBI-GeneID: 938130
NCBI-ProteinID: NP_388375
Pasteur: BG12112
BSORF: BG12112
UniProt: P96642 A0A6M3ZAZ1
Position
538836..541229
AA seq 797 aa
MQNKEKVESYKKKWQHLFEEITSYEDFHLMMYPSEYELEKRFKDLETDIAADAMDVARYY
NEETVRLLEQRLGRLTKYDFILGVKLKSSLVNISVELKDNILSFFNTATDTVVKMLGWEQ
NVSTSFFEKYEEVEETLANIMASVRGERLSETEMTYINRYHFVRGLKHQTNEESEIKDVR
SITNTIIDPTDPSVLHLHSDQDEGYSAFVVIDEFLHNMSESDLFYEAQSLPFPVEVQMKI
QTESKSITKPALNLKRQQLKEEQKEQQSTGDRSDVSTVTSATMIRHLQDEIKKEDVHVMN
WLSVIVVHGKTKKECVGKATIVKRHLKGAGITCRLPVADQLNLFYKMLPGEKLDITDKNW
IQKTTQDGVAESLFAVNSDIGSKIGFFLGWVDRFQEHTDLESAIMSSRDFVLFHPFLANQ
QLKGSKTRSPHCLITGDTGNGKSYLAKLIFNYISMLNIKSLYIDPKKEMRKWIQRVLNDE
YIRENFPLYIAHLEKYNYITLDHENTHNWGALDPISFLPPMKAKELVQVIFEQVYDFKGK
DDINTAFLRATSEVIDAKQKGEQVGSLDIIRKMQSHPEEAVQKAGDYLNEVVSDSILKLC
IHDGSNPALSLEKRITILEVENMDLPDHAERLENYTISQLKSSAVMFALGKFCELFGMNQ
DEQTVEFIDEAWIFTTSQQGKKVERQMRRIGRSYNNAEYFISQSTKDALKEEDSGNFGVA
FAFDEPNEREEVLKWMNMEVTKDNKKMMESMFQGQCLFKDYYGRTSKISIECLFEEWQGA
LKTVEKKAVAYAEEKYL
NT seq 2394 nt   +upstreamnt  +downstreamnt
atgcaaaataaagaaaaagttgaatcgtataaaaagaagtggcagcatctttttgaagaa
attacatcttatgaggattttcacttgatgatgtatccaagtgagtatgaattagaaaaa
cgatttaaggatttagaaacagatattgcggcagatgcaatggatgtggcacgttactac
aatgaagaaaccgtaaggctgttagaacagcgattaggaaggctgacaaagtacgacttc
attttaggtgtaaaactgaaaagcagtcttgtaaatattagtgtcgaacttaaagacaat
atactatcttttttcaatacagcgactgatacagtcgtgaaaatgctcgggtgggaacaa
aatgtttccacctctttttttgaaaaatatgaggaagtcgaagaaacactagcgaatatc
atggcttctgttcgcggagaacggctttcagaaacagaaatgacatacattaaccgttat
cactttgtacgtgggttaaagcaccaaacgaatgaagaaagtgagataaaggatgttcgc
tctattacaaacacgatcatagaccccactgacccatcagtattgcatttgcatagtgat
caagatgaaggctattcagcttttgtcgtgattgacgaatttcttcacaatatgtcggaa
agtgatttgttttatgaagcacagtctcttcccttccctgttgaagttcagatgaaaatt
caaacggaatcaaagtccattaccaagcctgccctcaacctcaaaagacagcaattgaaa
gaagaacaaaaagaacaacaaagcacaggcgatcgaagtgatgtttccactgtcacaagt
gccacaatgataaggcatttacaagatgaaataaagaaagaagatgtgcatgtgatgaac
tggctgtcggtgatagtcgttcatggaaagacaaaaaaagaatgtgtgggaaaagcaacg
attgtcaaaaggcatttaaaaggcgctggcattacttgtcggcttccggtggctgatcaa
ttgaaccttttttataaaatgcttcctggtgaaaagttagacataaccgataagaactgg
attcaaaaaacaacgcaagacggtgtggctgaaagtctgtttgctgttaactctgatatt
ggttcgaaaatcgggttctttctcggttgggttgatcgtttccaagagcacaccgactta
gaaagtgccattatgtccagccgtgattttgtcttattccaccctttcttagcgaatcag
cagttaaaaggttcaaagacacgttctcctcactgcttaatcacaggagacacaggaaac
ggcaagtcatatctagcgaaattgatctttaactatatcagcatgttaaacatcaaatct
ctgtatatagaccctaaaaaggaaatgagaaagtggattcaaagagtcttgaatgatgag
tacattagagagaactttcccttatatattgcacatttagagaaatacaactatatcacg
ctagatcatgaaaacacgcacaactggggagcgcttgaccctatctccttcctccctcct
atgaaagcaaaagagctagttcaagtcatttttgaacaagtatatgactttaaagggaag
gacgacataaacacagctttccttcgtgctacgtcagaagtgattgatgcgaaacaaaaa
ggtgaacaggtcggctcacttgatattattcggaagatgcagagccatcccgaagaagct
gtacaaaaagctggtgactatttaaatgaggtcgtgtcagattccattttgaaactttgt
attcatgatggttcaaatcctgcattgtcactagaaaagcgaattaccattttagaagtt
gaaaatatggatttgccggatcatgctgagcgacttgaaaactacacgatatcacaacta
aagtctagtgcggtcatgtttgcactaggtaagttctgcgagctattcggcatgaatcaa
gacgaacagactgttgaatttatagatgaagcttggatattcaccacgtcacaacaagga
aaaaaagtagaaagacaaatgcgccggattggtcgctcatacaacaatgcggaatacttc
atttctcaatccacaaaagacgctttaaaagaagaggattctggaaactttggcgttgcc
tttgcttttgacgaaccaaacgagcgtgaagaagtgttgaaatggatgaacatggaggtc
acaaaagataacaaaaaaatgatggaatccatgtttcaaggtcaatgcttatttaaagat
tactatggccgcacctctaaaatttcgattgaatgcctattcgaagaatggcaaggtgct
ctgaaaacagttgagaaaaaagccgtcgcatatgcggaagaaaaatatttgtaa

DBGET integrated database retrieval system