KEGG   Bacillus subtilis subsp. subtilis 168: BSU05760
Entry
BSU05760          CDS       T00010                                 

Symbol
ydhH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4944 SID-1_RNA_chan
Other DBs
NCBI-GeneID: 939877
NCBI-ProteinID: NP_388457
Pasteur: BG12185
BSORF: BG12185
UniProt: O05500 A0A6M3Z8J8
Position
complement(622293..622790)
AA seq 165 aa
MSSHYKYPLIFTAFLLIAFCLIFFSYHLIHHVRLEYPNWQGESKDQNWEAVFTKNEDAPN
EYSGKLYWIGDTIEIDNTYLESLIVKKDDEVLLSSDTEIPMHDYAGGTFSDGSAKEKSVS
FLERLDEHELEGHDITIEVKWKQGNHYSASQLTLNEKTLFDEKQQ
NT seq 498 nt   +upstreamnt  +downstreamnt
atgtccagtcattataaataccctctcattttcacggcattcctattaatcgctttctgc
ttgatctttttttcctatcacctgattcatcatgttcgtttggagtatccaaattggcag
ggagaaagcaaagatcagaattgggaagctgttttcacaaaaaatgaagatgcaccgaat
gaatacagcggcaaactttattggatcggtgatacaattgaaatagacaacacttatctg
gaatcactgattgtaaaaaaggatgatgaagttctgctgagttctgacacggaaatcccg
atgcatgattatgctggaggcactttttctgatggaagcgcaaaagaaaagtccgtttct
tttttagagcggttagatgaacatgagcttgaaggccatgatattacgattgaagtgaaa
tggaaacaaggtaatcattattctgcgagtcagcttacgctcaatgaaaagaccttgttt
gatgaaaagcagcaatag

DBGET integrated database retrieval system