KEGG   Bacillus subtilis subsp. subtilis 168: BSU06270
Entry
BSU06270          CDS       T00010                                 

Symbol
ydjO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YdjO
Other DBs
NCBI-GeneID: 936021
NCBI-ProteinID: NP_388508
Pasteur: BG12805
BSORF: BG12805
UniProt: O34759 A0A6M3ZDB9
Position
complement(681255..681464)
AA seq 69 aa
MSYYNKRNQEPLPKEDVSTWECTKEDCNGWTRKNFASSDTPLCPLCGSKMVDGIRSLVNL
QNNSQTKTS
NT seq 210 nt   +upstreamnt  +downstreamnt
atgtcttactataacaaacgaaatcaagaaccgctgccaaaggaagatgtgagtacttgg
gaatgcacaaaagaagactgtaatggctggacccgaaaaaacttcgccagcagtgatacg
ccattgtgccctttgtgcggaagtaaaatggtcgacggcatccgttcattagtgaatctc
caaaacaacagccaaacgaaaacaagctag

DBGET integrated database retrieval system