KEGG   Bacillus subtilis subsp. subtilis 168: BSU06350
Entry
BSU06350          CDS       T00010                                 

Symbol
yebA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Transglut_core TgpA_N DUF4129 Orf78 DUF2207 DUF6548 Psg1 DUF2682
Other DBs
NCBI-GeneID: 936029
NCBI-ProteinID: NP_388516
Pasteur: BG12213
BSORF: BG12213
UniProt: P94476 A0A6M4JDN3
Position
690364..692577
AA seq 737 aa
MPHDDHKGSRLSLLLFYFLAFLLLWEWLRPLDSFTETKHTGFFSVFIGLTFLLTFFRMRW
FVTVPFCVIFTLISIHILFYQGSIFDLSWVSSFLQDVYLNITLIQSGQWNDMIPSFRTLL
FFVLLWLLVYLLHYWVIYQRRILFFFLMTVAYITILDTFTPYDATFAVIRIVLIGFFMLG
LLYLERIKLMERITLPKTSVLKWFLPLSVLVLAATGFGLAAPKSEPAWPDPVPFLKKITH
QDRVSAGESKIGYGNHDESLGGPFQQDATPVFTWQGKERTYFRVETKDTYTGKGWIETDT
GMSYQLSNGKVENLWFDHKVATERRTVRVKVDKHYGYNHLMYPIGAETIQPKQAVSLEMN
GNTEQISPISEQAGEIRNMGNYTVTYNSPVYKLDELRKVKVRKNSEEYTFSDRYMQLPDS
LPERVRTLAIKLTQDHDNMFDKVKAVEDYLGSNAFTYETENVTIPKNDEDYVDQFLFETK
MGYCDNFSSAMVVLLRSAGIPARWVKGYTSGEYKEAGNKNGSIYEVTNNNAHSWVEVYFP
EQGWVTFEPTKGFTNPAQFTSSDTKDSGSDSSSSPKKAKEKQKEEKKQPQKEEKQKEKRE
PAVSKKPSASHTNAGAGLYAALAVLAVLLVAAVLLYVFRSLWIPVFAVRKLKRRSDQHAF
FEAYGALLKQLKRKGLPKRDSETLRDYAKRIDEKYDIEDMSKLTLSYERALYRNEDSSAL
WNDSRELWENLIKRRWS
NT seq 2214 nt   +upstreamnt  +downstreamnt
atgccgcacgatgatcacaagggaagccgtttgagcttgctgttattttattttctggct
tttttattgctgtgggagtggcttaggccgcttgacagttttactgaaacgaaacataca
ggcttttttagtgtctttatcggcttgacgtttctgctgacttttttcaggatgaggtgg
tttgtcaccgttcctttttgtgtcatatttacattgatctcgatacacatcctgttttat
caaggatctatattcgacttgagctgggtcagctcttttttgcaggatgtctatctgaat
atcacgctgattcaatcagggcaatggaatgacatgattccttcatttcggaccctgctg
ttttttgtgctgctgtggctgctggtctatctcctgcattattgggtgatttaccagaga
agaattttgtttttctttttgatgacagtagcgtatattacgattcttgatacctttacg
ccatatgatgccacttttgccgtaatccgtatcgtgctgatcggcttctttatgctgggc
cttttatacttggaacgcattaagctgatggaaagaatcacactgccaaaaacatctgtc
ctgaaatggtttcttcctttatctgtattggttttggctgcaacgggattcggactcgcc
gctccaaaatcagagccggcttggcctgatccggtgccttttcttaaaaaaatcactcat
caagaccgcgtgtctgcaggggaaagcaaaatcggatacgggaatcatgatgaatcactc
ggcggcccgttccagcaggatgctacacctgtttttacatggcagggaaaagagcgtacg
tatttccgtgtggaaacgaaggacacgtataccggaaaaggctggattgaaacagacaca
ggcatgtcgtatcagcttagcaatggaaaagttgaaaatctgtggtttgaccataaggtt
gcgacagagcgccgcaccgtccgtgtaaaagtcgataagcactacgggtataaccatctg
atgtatccgattggtgcggaaaccattcagccaaagcaggctgtctcacttgaaatgaac
ggcaacacggagcaaatttctccgatcagtgaacaagccggtgaaatcagaaatatgggg
aattatacagtaacgtacaattccccggtctataagctggatgaactgagaaaggtaaaa
gtgagaaaaaacagtgaggagtacacattcagcgatcgctacatgcagcttccagattca
ctgccagagcgggtgagaacccttgcgatcaaactgactcaggatcacgacaatatgttt
gataaggtgaaagcggttgaggactatttagggtcaaatgcgttcacatatgaaacagaa
aacgtgaccattccgaagaatgatgaagattatgtcgatcaatttctctttgaaacgaaa
atgggttattgtgataacttttcttccgccatggtggtgctcttgcgctcggccggcatt
ccggcccgctgggtaaagggttatacgtccggcgaatacaaagaagcagggaacaaaaat
ggcagcatttacgaagtgacaaataacaatgcccattcctgggtagaggtgtatttcccg
gaacagggctgggttacatttgagccgactaaagggtttacaaatccggctcaatttaca
tcttctgacacaaaagactctggcagcgatagcagcagctcgccgaagaaagcaaaagag
aaacagaaagaagagaaaaaacagccgcaaaaagaggaaaaacaaaaggaaaagcgggag
ccagctgtttctaaaaagccgtccgcttcgcatactaatgccggtgcgggcttgtatgca
gcgcttgcggttcttgcagtcctcctggtggcagctgtattgctgtatgttttccgctcg
ttatggattcctgttttcgccgtgaggaaattgaagcggcgcagtgatcagcacgcgttt
tttgaggcatatggcgcgctgctgaaacaactgaagagaaaaggactgccgaaacgagac
agtgaaacgctgcgtgattatgcaaaacgaattgatgaaaaatacgacatagaagacatg
tcaaagctgacattaagctatgaaagggcgctttacagaaatgaagattcttcggcgcta
tggaatgattcgagagagttatgggaaaatttaattaaaagaagatggtcttga

DBGET integrated database retrieval system