KEGG   Bacillus subtilis subsp. subtilis 168: BSU06610
Entry
BSU06610          CDS       T00010                                 

Symbol
pcrA
Name
(RefSeq) ATP-dependent DNA helicase PcrA
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03420  Nucleotide excision repair
bsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    BSU06610 (pcrA)
   03430 Mismatch repair
    BSU06610 (pcrA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU06610 (pcrA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     BSU06610 (pcrA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BSU06610 (pcrA)
   MMR (mismatch excision repair)
    Other MMR factors
     BSU06610 (pcrA)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 Viral_helicase1 ResIII Terminase_6N Com_YlbF
Other DBs
NCBI-GeneID: 938747
NCBI-ProteinID: NP_388543
Pasteur: BG12834
BSORF: BG12834
UniProt: O34580 A0A6M4JKU6
Position
719370..721589
AA seq 739 aa
MNYISNQLLSGLNPVQQEAVKTTDGPLLLMAGAGSGKTRVLTHRIAYLMAEKHVAPWNIL
AITFTNKAAREMKERVESILGPGADDIWISTFHSMCVRILRRDIDRIGINRNFSILDTAD
QLSVIKGILKERNLDPKKFDPRSILGTISSAKNELTEPEEFSKVAGGYYDQVVSDVYADY
QKKLLKNQSLDFDDLIMTTIKLFDRVPEVLEFYQRKFQYIHVDEYQDTNRAQYMLVKQLA
ERFQNLCVVGDSDQSIYRWRGADITNILSFEKDYPNASVILLEQNYRSTKRILRAANEVI
KNNSNRKPKNLWTENDEGIKISYYRGDNEFGEGQFVAGKIHQLHSTGKRKLSDIAILYRT
NAQSRVIEETLLKAGLNYNIVGGTKFYDRKEIKDILAYLRLVSNPDDDISFTRIVNVPKR
GVGATSLEKIASYAAINGLSFFQAIQQVDFIGVSAKAANALDSFRQMIENLTNMQDYLSI
TELTEEILDKTEYREMLKAEKSIEAQSRLENIDEFLSVTKNFEQKSEDKTLVAFLTDLAL
IADIDQLDQKEEESGGKDAITLMTLHAAKGLEFPVVFLMGLEEGVFPHSRSLMEEAEMEE
ERRLAYVGITRAEQELYLTNAKMRTLFGRTNMNPESRFIAEIPDDLLENLNEKKETRATS
ARKMQPRRGPVSRPVSYASKTGGDTLNWAVGDKAGHKKWGTGTVVSVKGEGEGTELDIAF
PSPVGVKRLLAAFAPIEKQ
NT seq 2220 nt   +upstreamnt  +downstreamnt
ttgaattatattagcaatcaattactaagcggtttaaaccccgttcagcaggaagcagtc
aaaacaacggacgggcctcttttgctgatggcgggagcgggtagcggaaagacgcgtgtc
ctgacccatagaattgcttatttaatggcagaaaagcatgtggcgccgtggaacattctg
gcgatcacatttacaaataaagcggcacgcgaaatgaaagaacgtgtggaaagcatcctc
ggacccggcgcggacgatatctggatctccacattccacagcatgtgcgtgcggatcttg
cgcagagatatcgaccggattgggatcaaccgaaatttctccatccttgatacggctgac
cagctttcagtgatcaaggggattttgaaggagcgcaatcttgatccgaagaagtttgac
ccgagaagcatcctcggcacgatcagcagtgcaaaaaacgaattgaccgaaccggaggaa
ttctctaaagttgctggcggctactacgatcaggtggtcagcgatgtatatgctgattat
cagaagaagctattgaaaaaccagtcgctcgatttcgacgatttaattatgacgacgatt
aaactgtttgacagagtgcctgaagtgcttgaattttatcagcgcaaattccagtacatc
cacgttgatgagtatcaggatacgaacagggcacaatacatgctcgttaagcagcttgcc
gagcgtttccagaacctttgcgttgtgggggattctgatcagtcaatctacagatggcgc
ggcgcggatatcaccaacattctttcatttgaaaaagattatccgaatgcaagcgtgatt
ttgctagaacaaaactatcgttcaacgaaacggattttgcgcgcggctaacgaggtcatt
aaaaacaactctaaccgcaaaccgaaaaatttgtggacggaaaatgatgaaggcatcaag
atttcctattatcgcggtgataatgagttcggtgaaggacagtttgtggccggcaaaatt
catcagcttcacagcacaggcaagcggaagctgtcggatatcgccatattataccggaca
aacgcgcagtcccgtgtgattgaggaaacgcttctcaaagcgggcttgaactataacatt
gtcggcggcacaaagttctatgacagaaaagaaattaaagacattcttgcgtacctgcgc
ctcgtatccaatccggatgacgatatcagtttcacgcgcattgtcaatgtgccgaagcgc
ggagtcggcgcgacatcacttgaaaaaatcgcttcgtatgcggccataaacggcttgtcc
tttttccaagcgattcagcaggttgattttatcggcgtcagtgccaaagcggcaaacgcg
cttgacagctttagacagatgattgaaaacctgaccaatatgcaggattacttatccatt
acagagctgacagaagaaattcttgataagacggaatacagagaaatgctgaaggctgag
aaatcgatcgaagcccaaagccgtttagaaaatatcgacgagttcctgtctgttacgaaa
aactttgaacagaaaagtgaagacaagacactcgttgcgttcctgacagacttggcattg
atcgcagatattgatcagctcgatcagaaggaggaagagtcaggcggcaaggatgcgatc
accctgatgacactgcacgccgcgaaaggactggagtttccggttgttttcttgatgggg
cttgaagaaggcgtcttcccgcatagccgttcactcatggaggaagcggaaatggaagaa
gaacgccgccttgcgtacgttgggattacaagggcggaacaggagctttatctgaccaat
gctaaaatgcgcaccttgtttggccggacaaatatgaacccggaatctcgcttcattgct
gaaataccggatgatttattggaaaacctaaatgagaaaaaagaaacaagagcgacgtct
gcgagaaaaatgcagccgagacgcggccctgtttcacgcccggtatcctacgccagcaaa
acaggcggcgacaccttgaactgggcagtcggagataaggcgggccataaaaaatgggga
acaggaactgtcgtcagcgtgaaaggcgaaggagaagggacagagcttgatattgccttc
ccgagccctgtcggcgtgaaacgcctgttagcagcatttgctcctattgaaaagcagtaa

DBGET integrated database retrieval system