KEGG   Bacillus subtilis subsp. subtilis 168: BSU06760
Entry
BSU06760          CDS       T00010                                 

Gene name
yeeA
Definition
(RefSeq) DNA methyltransferase YeeA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: N6_Mtase DUF3480
Other DBs
NCBI-GeneID: 936059
NCBI-ProteinID: NP_388558
Pasteur: BG12818
BSORF: BG12818
UniProt: O31504 A0A6M4JDS6
Position
740288..742927
AA seq 879 aa
MALIDLEDKIAEIVNREDHSDFLYELLGVYDVPRATITRLKKGNQNLTKRVGEVHLKNKV
WFKEAKKGKLFDALIDIEQQVEYLSAKPRYLLVTDYDGVLAKDTKTLEALDVKFEELPQY
FDFFLAWKGIEKVEFEKENPADIKAAERFARIYDVLRKENNIIETNRGLDLFLIRLLFCF
FAEDTDIFKRNSFTNLIKTLTEEDGSNLNKLFADLFIVLDKNERDDVPSYLKEFPYVNGQ
LFTEPHTELEFSAKSRKLIIECGELLNWAKINPDIFGSMIQAVASEESRSYLGMHYTSVP
NIMKVIKPLFLDKLNQSFLDAYDDYTKLENLLTRIGKIKFFDPACGSGNFLIITYKELRR
MEINIIKRLQELLGEYLYVPSVTLSQFYGIEIEDFAHDVAKLSLWIAEHQMNEELKNEVH
NAVRPTLPLHTAGDIRCANAIRVEWTEVCPAQGSEEVYVFGNPPYLGSKKQNKEHKSDML
SIFGKVKNGKMLDYISAWFYFGAKYASTTNAKVAFVSTNSVTQGEQVSILWNELFKFGIQ
INFAYKSFKWANNAKNNAAVIVVIVGFGPLDTKVNKYLFVDETKKLVSNISPYLTDGENI
LVSSRTKPISDLPKLHFGNMPNDGGGLLFTITEYTDAINKYPELVPYFKKFIGSVEFING
GLRYCLWLNEAKYEKIKSNPLIQERISISKNHREKSTDKGTNKLALTPWKFRDTHETTNY
SIVVPSVSSENRFYIPMGLAGADTILSNLIYVIYDAEIYLLGILMSRMHMTWVKAVAGRL
KTDYRYSAGLCYNTFPIPELSTRRKNEIEEAILEILDLREEQGGTLAELYNPSTMPIELK
VAHEKLDGIVERAYRQKQFESDEERLEVLLKLYQEMTER
NT seq 2640 nt   +upstreamnt  +downstreamnt
atggcgctcattgatttagaagataaaattgctgaaatagtgaatcgagaagatcattca
gatttcttgtatgaattactcggtgtatatgatgttccacgagctacaattacgcgcttg
aaaaaaggaaatcaaaaccttacaaaacgggttggtgaagtacacttaaagaataaggtg
tggtttaaggaggctaagaaaggaaagctctttgacgcccttattgatatagaacaacaa
gttgaatatctttcagctaagccacgatatttattagttactgactatgatggagtatta
gcgaaagatacaaaaacattagaggctcttgatgttaaatttgaagaacttcctcagtat
ttcgatttcttccttgcttggaaaggtattgagaaagtagagtttgaaaaggaaaacccc
gctgatattaaagcagccgaacgttttgcacggatatatgatgtacttcgtaaagaaaac
aatattattgagactaatagagggttagatttatttcttattcgtttactgttttgtttt
ttcgcagaagatactgacatcttcaaacgaaatagttttacgaatttaattaagactttg
actgaagaagatggttcaaatctaaataaattatttgctgatttatttatcgtgttagat
aaaaatgaacgagacgatgttccatcttatttaaaagagtttccgtatgtaaatggccag
ttgtttactgaaccacatacagagttggaattttctgccaaatccagaaagttaattatt
gagtgcggtgaattattaaactgggctaaaatcaatcctgatatctttggttcaatgatt
caagctgttgcttctgaagaaagccgtagttatttaggtatgcactacacaagtgtcccc
aatataatgaaggttattaaaccgcttttcctagataaacttaatcagtcttttttagat
gcatacgatgattatacaaaacttgaaaatcttctaacacgaatcggcaaaattaaattc
tttgatcctgcatgtggttcagggaactttttgattattacctacaaagaattacggcgt
atggaaatcaatattataaaacgacttcaagaactcttgggagagtatctttatgtacct
tcagtaactttatctcaattttacggaatagagattgaagattttgcacatgacgttgca
aaattatcactttggattgctgaacatcaaatgaatgaagaattaaaaaatgaagttcat
aatgcagtacgcccaacgttaccacttcatacagcaggggatattcgttgtgcaaatgct
attagggttgagtggactgaggtttgtcccgcacaaggatctgaagaagtatatgttttt
ggtaatccaccgtatcttggttcaaaaaaacaaaacaaagaacataaatctgatatgtta
tcaatttttggaaaagtcaagaatggtaaaatgcttgattatatttctgcttggttttac
tttggtgctaaatacgcttcaactacaaatgcaaaagttgcctttgtatcaacaaattca
gttactcaaggggaacaggtttctatcttatggaatgagttattcaagtttggaattcaa
atcaattttgcctataaatcttttaaatgggcgaataatgctaaaaataatgctgcggta
attgttgtgattgtaggttttggcccgttagataccaaagtaaacaagtatttatttgtt
gatgaaacgaaaaagctagtttctaacattagtccctatttaactgatggtgaaaatatt
cttgtttcttctaggacgaagccaatttcagacttacccaaactgcattttgggaacatg
cctaatgatggcggaggattactctttaccattacggaatatacagacgcaatcaataag
tatcctgaattagttccctattttaaaaagtttataggttcagtagagtttattaatggt
ggtttacggtattgtttatggcttaatgaagcaaaatatgaaaaaataaagtctaatcct
ctaatacaagaaagaatctcaatttcaaaaaatcacagggaaaaatcaacagataaagga
acgaataaacttgcattaactccgtggaagtttagagatactcatgaaacaactaattat
tccattgttgttccatctgtgtcttctgaaaatagattttatattccaatgggattagca
ggtgcagatacaattttgtcaaatctaatttatgtaatttacgatgcagaaatttacctt
ctaggcattttgatgtcacggatgcatatgacttgggtaaaagctgtagccggaagatta
aaaactgactataggtactctgcaggtttatgttataacactttccctattcctgaatta
tcaacaagaaggaagaatgaaattgaagaagcaattcttgaaattcttgatcttcgtgaa
gagcagggtggtacattagcagagctttataacccttcaacaatgccaattgaattaaaa
gtagcacatgaaaagttggatggaattgtagaaagagcgtatcgtcaaaaacaatttgaa
tctgatgaagaacgcttagaagtattgcttaaattgtatcaagaaatgacagaacggtag

DBGET integrated database retrieval system