KEGG   Bacillus subtilis subsp. subtilis 168: BSU06770
Entry
BSU06770          CDS       T00010                                 

Symbol
yeeB
Name
(RefSeq) ATP-dependent helicase YeeB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ResIII DEAD Helicase_C PAS_6 AAA_19 DDE_Tnp_1_assoc
Other DBs
NCBI-GeneID: 936068
NCBI-ProteinID: NP_388559
Pasteur: BG12819
BSORF: BG12819
UniProt: O34469 A0A6M3ZDH5
Position
742939..744738
AA seq 599 aa
MENIIEINYNQTGKSKKTNEYGMREMQARAFEKRNSQYLLVKAPPASGKSRALMFIGLDK
LINQGLRKVIVAVPERSIGSSFKNTDLKSYGFFENWKVDPRNNLTVGGDNSKVKSFVRFM
ESDDQVLICTHSTLRFAFEKIDDKAFDNCLLAIDEFHHVSADVNSRLGELLRSIIHNSSA
HIVAMTGSYFRGDSVPILLPEDEELFDKVTYSYYEQLDGYEYLKGFGIGYHFYQGQYTSA
INEVLDTNKKTIVHIPNVNSGESTKDKYDEVGKILDMIGEVEYQDDDTGIIYVKRHSDGK
TLKIADLVDDQVGRENVVAYLRNIEALDDLDIIIALGMAKEGFDWPFCEHTLTVGYRGSL
TEIVQIIGRCTRDSYNKTYAQFTNLIAMPDAKDEVVTYTVNTMLKAISASLLMEQVLTPD
FKFKRRRNESEKSSTTGELFVKGLKEPSTENVKKIIENDINDLKAKIMQDSQVQKTFSGE
VDPKVLNKVLIPKVIQKVYPNLSDEEIEEVRQHVVLDTVMKGAKSEVVGSKEFIRMADKF
INIEDLDINLIDSINPFQKAFEVLSKELNSPVLKLIQETIDAKRINFDEDELVFIWPKV
NT seq 1800 nt   +upstreamnt  +downstreamnt
atggaaaatataattgaaattaattataaccaaactggtaaaagtaagaaaacaaatgaa
tacggtatgcgtgaaatgcaggcaagagcttttgaaaaacgtaactcacaatatctctta
gttaaagcaccgccagcttctgggaaatctagagctttaatgtttatcggtttggataag
ctcataaatcaaggtttgaggaaagtgattgttgctgtacctgaacgctctataggttct
tcatttaaaaatacggatttaaaaagttatggtttctttgaaaattggaaagttgatcct
agaaataatttaactgttggcggagataactctaaggttaaatcttttgttcgttttatg
gaatcggacgatcaggtgttaatatgtacgcactctactttgcgatttgcgtttgaaaaa
attgatgataaagcatttgataattgtttacttgcaatagatgaatttcaccatgtatcg
gcagatgtcaattctcgattaggtgaattgttaagaagtattattcataattcatcagca
catattgtagcgatgactgggtcgtatttccgtggagattctgtaccaattttattacca
gaagatgaggaattatttgacaaggtaacttattcctattatgaacaacttgatggatat
gaatatctaaagggatttggtataggatatcacttctatcaaggccagtacacatcagct
attaatgaagtattggatacaaataagaaaacaatcgttcatattccaaatgtaaactca
ggggaatcgacaaaggataagtacgatgaagttggtaagatacttgatatgattggtgaa
gttgaatatcaagatgatgatactggaattatttatgttaagcgacattctgacggtaaa
acattgaaaattgcagatttagtagatgaccaagttggaagagaaaatgtcgttgcgtat
ttgcgtaatattgaagccctagacgatttagatataattattgctcttggtatggcgaaa
gagggctttgactggccgttttgtgaacatactttgacagttggttatcgtggctcactt
acagaaatagtacaaataattgggcgctgtacacgtgatagttacaataaaacctatgct
caatttaccaacctaatcgcaatgcctgatgcaaaggatgaagtagtgacttatacagtg
aatacaatgcttaaagctatttctgcctcacttttgatggagcaggtccttacacctgac
tttaaatttaaacgtagaagaaatgaaagtgaaaaatcttctactacaggagaattattc
gttaagggattgaaagaaccatcaacagaaaatgtcaaaaagattattgaaaatgatatt
aatgatttaaaagcaaaaatcatgcaagattcacaagtccaaaaaacatttagtggagaa
gtagatcccaaagtattgaacaaagtgttgattccgaaagttattcaaaaagtatatcca
aatttatcagatgaggaaattgaggaagttagacagcacgttgttctagatacagttatg
aaaggtgctaagtctgaagttgtaggaagtaaagaatttataagaatggcagataagttt
ataaacattgaggatttagatatcaatctgattgattccatcaatccgttccaaaaagca
tttgaggttctatcgaaagaattgaactcaccagtgctaaaactgattcaggaaactatt
gatgcaaaacgtattaattttgatgaagatgaactagtattcatatggccaaaggtttag

DBGET integrated database retrieval system