KEGG   Bacillus subtilis subsp. subtilis 168: BSU06850Help
Entry
BSU06850          CDS       T00010                                 

Gene name
yeeK
Definition
(RefSeq) spore coat protein YeeK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1908 Sporozoite_P67
Motif
Other DBs
NCBI-GeneID: 936073
NCBI-ProteinID: NP_388567
Pasteur: BG12825
BSORF: BG12825
UniProt: O31510
Position
753265..753702
Genome map
AA seq 145 aa AA seqDB search
MTDTRHMYGGPGFGHYQGFGIGHPGYGMQSTGYPGYGMYGGHPGYGMQGYPDHGIHGGVG
GYPGYGGYGGYPSGGYGGSPGTGSYPSMHHENDGHHHYYHHHHDGKDNLHHHHHHVGKDN
HHHHHDGHYGHHHHHMGHWGKDGYK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgactgatacaagacatatgtatggcggacctggttttggtcattatcagggctttggt
attggccacccgggctatggcatgcaaagcacaggctatccgggctatggcatgtatgga
ggccacccgggctatggcatgcaaggctacccagatcacggcatacatggaggagtcggc
ggctatccgggatatggtgggtacggcggttacccaagcggcggctatggaggctctccg
ggaactggaagctatccgagcatgcaccatgaaaatgatggccatcaccactattatcac
catcatcatgatggaaaagataatcttcatcaccatcatcaccatgttggaaaggataat
catcaccaccatcatgatggtcattatggccaccatcatcaccatatgggccactgggga
aaagacggttataaataa

DBGET integrated database retrieval system