KEGG   Bacillus subtilis subsp. subtilis 168: BSU06850
Entry
BSU06850          CDS       T00010                                 

Symbol
yeeK
Name
(RefSeq) spore coat protein YeeK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1908 Sporozoite_P67
Other DBs
NCBI-GeneID: 936073
NCBI-ProteinID: NP_388567
Pasteur: BG12825
BSORF: BG12825
UniProt: O31510 A0A6M4JDT5
Position
753265..753702
AA seq 145 aa
MTDTRHMYGGPGFGHYQGFGIGHPGYGMQSTGYPGYGMYGGHPGYGMQGYPDHGIHGGVG
GYPGYGGYGGYPSGGYGGSPGTGSYPSMHHENDGHHHYYHHHHDGKDNLHHHHHHVGKDN
HHHHHDGHYGHHHHHMGHWGKDGYK
NT seq 438 nt   +upstreamnt  +downstreamnt
atgactgatacaagacatatgtatggcggacctggttttggtcattatcagggctttggt
attggccacccgggctatggcatgcaaagcacaggctatccgggctatggcatgtatgga
ggccacccgggctatggcatgcaaggctacccagatcacggcatacatggaggagtcggc
ggctatccgggatatggtgggtacggcggttacccaagcggcggctatggaggctctccg
ggaactggaagctatccgagcatgcaccatgaaaatgatggccatcaccactattatcac
catcatcatgatggaaaagataatcttcatcaccatcatcaccatgttggaaaggataat
catcaccaccatcatgatggtcattatggccaccatcatcaccatatgggccactgggga
aaagacggttataaataa

DBGET integrated database retrieval system